cara menang main slot fire 88-🎖️pk88 login|XOXE88.COM

AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezerPudihangLumiuatauBharadaEseusaimenjalanipemeriksaandikantorKomnasHAM,Jakarta,Selasa(26/7).Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-KomisiNasionalHakAsasiManusia(KomnasHAM)memeriksasatuorangajudanatauaidedecamp(ADC)danasistenrumahtanggaIrjenFerdySambopadaSenin(1/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Keduanyamenjalanipemeriksaanmulaiscara menang main slot fire 88ekitarpukul10.00WIBdanbaruselesaisekitarpukul17.15WIB.AjudanFerdySamboyangdiperiksaolehKomnasHAMpadaSeninkemarinsebelumnyaberhalanganhadir.BacaJuga:ArmanHarisUngkapKondisiTerkiniIstriFerdySamboPadaSelasa26Juli2022,KomnasHAMmengagendakanpemeriksaanterhadaptujuhorangajudanFerdySambo.Namun,hanyaenamyangdatangsalahsatunyaBharadaE.AgendaawalSenin(1/8),KomnasHAMjugaakanmemeriksaataumenggaliinformasidaripetugaskesehatanyangmelakukantesusapPCRdikediamanpribadiIrjenFerdySambodiJalanSaguling,DurenTigaJakartaSelatan.BacaJuga:IniHargaMobilMewahKomjenAgusyangMendatangiRumahFerdySambo,YaAmpun!Namun,kataKomisionerKomnasHAMRIBekaUlungHapsara,tenagakesehatanyangmelakukantesusapPCRtersebuttidakmemenuhiundanganpemeriksaan.Berikut5kabarterbaruperkembanganpengusutankasuskematianBrigadirNofriansyahYoshuaHutabarataliasBrigadirJyangdilakukanKomnasHAMhinggaSenin:

SkuadPSMMakassardalamsebuahlagadiLiga12022/23.Foto:LigaIndonesiaBaru.jpnn.com,MAKASSAR-PSMMakassarakanmenjamuKedahFCpadasemifinalAFCCup2022zonaASEAN.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});PertandinganiniakanberlangsungdiStadionKaptenIWayanDipta,GianyarBali,Selasa(9/8/2022).DuelPSMvsKedahFCdiprediksibakalketatsangsengit.Sebab,keduatimsama-samaberambisimerebutkemenanganagarloloskebabakberikutnya.BacaJuga:PelatihKedahFCTebarAncamankePSMMakassar,Sorot1PemainDalamlagaini,PSMmaupunKedahFCbakalmenurunkanskuadterbaiknya.Kamiakanbekerjaekstrakerasuntukmeraihkemenangan,kataPelatihPSMMakassar,BernardoTavares,Senin(8/8/2022)siang.TimtertuadiIndonesiaitukemungkinanmenurunkanEvertonNascimento,YakobSayuri,danRezkiEkadilinidepan.BacaJuga:SambutHUTke-77RI,PelatihPSMMakassarPunyaPesanPentinguntukSuporterKemudian,PSMbakalmengandalkanWiljanPluim,RasyidBakri,sertaArfanditengah.Sementaraitu,YuranFernandes,ErwinGutawa,YanceSayuri,danAgungMannanakanmenjagabentengpertahananPasukanRamang.Terakhir,RezaAryaPratamabakalmenjadipemainterakhirdibawahmistar.PetugaspemadamkebakaranberjibakumemadamkanapiyangmembakarMazdaCX7.Foto:CuciHati/jpnn.comjpnn.com,ILIRBARAT-MobilSUVMazdaCX7nomorpolisiD1584IYwarnaputihterbakardiJalanHuluBalang,KelurahanDemangLebarDaun,KecamatanIlirBaratI,Palembang,Senin(8/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1600966010cara menang main slot fire 88670-0);});PemilikmobilOscarFauzi(42),wargaJalanBankRayaII,KelurahanDemangLebarDaunmengungkapkankronologikejadianbermulasekitarpukul14.30WIBseusaimengisibahanbakarminyak(BBM)PertamaxdiSPBUJalanHuluBalang.SetelahmengisiBBMterdengarsuaraletusandaribandepankananmobil,kemudianmunculapi.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanOscarbersamaistridanketigaanaknyalangsungkeluardarimobiluntukmenyelamatkandiri.Jadi,awalmulaituadasuaraletusandaribandepankanan,kemudianapitiba-tibamuncul,sayabersamaistridanketigaanakkeluar,mobilpunmeledakdanterbakar,ungkapdia.Oscarmengakusebelumkejadiantidakadakejanggalandimobil.BacaJuga:SiswaSMPTewasDitusukdiSekolah,PelakunyaTakAdayangMenyangkaWaktuperjalanandarirumahtidakadatanda-tandakejanggalanapa-apa.Mobilinijugasebenarnyajarangdipakai,karenahabisbensinmakanyamaudiisi,jelasnya.SatuunitmobilPemadamKebakaran(Damkar)PemkotPalembangdidatangkanuntukmemadamkanapi.

cara menang main slot fire 88-🎖️pk88 login|XOXE88.COM

TunggalputriIndia,PusarlaV.Sindhu..Foto:BadmintonPhoto-BWFjpnn.com,BIRMINGHAM-IndiamemborongtigamedaliemasdariajangCommonwealthGames2022yangdihelatdiBirmingham,Inggris.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});TigawakilIndiayangsuksesnaikpodiumtertinggiantaralainLakshyaSen(tunggalputra),PusarlaV.Sindhu(tunggalputri),sertaChiragShetty/SatwiksairajRankireddy(gandaputra).LakshyaSenmerebutemasseusaimengalahkantunggaputraMalaysia,NgTzeYong.BacaJuga:AFCCup2022:PrediksiSusunanPemainPSMMakassarvsKedahFCPemainranking10duniaitumengalahkanTzeYonglewatpertarungantigagimdenganskor19-21,21-19,21-16.KemenanganSendiikutiolehrunnerupOlimpiadeRio2016,PusarlaV.Sindhu.KampiunSingaporeOpen2022itumenangdenganskor21-15,21-13atasMichelleLi(Kanada).SatulagiwakilIndiayangberjayadiCommonwealthGames2022ialahChiragShetty/SatwiksairajRankireddy.BacaJuga:CommonwealthGames2022:NgTzeYongMenggila,LeeChongWeiBeriPetuahPentingJawaraIndiaOpen2022itumengatasiperlawananwakiltuanrumahBenLane/SeanVendyduagimlangsung,21-15,21-13.Dengankemenanganini,Indiatercatatmembawapulangtigamedaliemasdarisektorperorangancaborbulutangkis.HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).FotoIlustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});InvestasisafeheavenberbalikmenguatdaripenurunanakhirpekanlaludanbertenggerdiataslevelpsikologisUSD1.800perounce.PenguatanhargaemasditopangolehgreenbackyanglebihlemahmenjelanglaporaninflasiutamaAmerikaSerikat.BacaJuga:HargaEmasPegadaian,Sabtu6Agustus2022,AntamdanUBSKompakNaikKontrakemaspalingaktifuntukpengirimanDesemberdidivisiComexNewYorkExchange,terdongkrakUSD14atau0,78persen,menjadiditutuppadaUSD1.805,20perounce.EmasberjangkaanjlokUSD15,7atau0,87persenmenjadiUSD1.791,20padaJumat(5/8),setelahmelonjakUSD30,5atau1,72persenmenjadiUSD1.806,90padaKamis(4/8).IndeksUSDyangmengukurgreenbackterhadapenammatauangutamalainnya,turun0,17persenmenjadi106,4360,karenainvestormenunggudatainflasiASyangakandirilispadaRabu(10/8),membuatemaslebihmurahbagipemegangmatauanglainnya.BacaJuga:HargaEmasHariIniMerosotTajam,AmbyarEmasjugamenemukandukungantambahandariimbalhasilobligasipemerintahASyangturundanpembalikankeuntunganawalpadasaham-sahamAS.JikaWallStreetdanaset-asetberisikotetapdalamtrenpasarbearish,makakitaharusmengabaikansinyalinidenganrisikokitasendiri,kataanalisekuitasStoneX,FawadRazaqzadadalamkomentarnyapadaSenin(8/8).PengacaraBharadaE,DeolipaYumaradanMuhammadBurhanuddindikantorLPSK,JakartaTimur,Senin(8/8).jpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangSenin(8/8)tentangBharadaEmengakusudahlegakarenamembongkarkasusBrigadirJ,sementaraituDahlanIskanmenuliskcara menang main slot fire 88anrahasiabesarsoalkasusBrigadirJ,hinggaselainpelecehanseksualDahlanjugamenuliskansoalurusancintaPutriCandrawathi.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarBacaJuga:5BeritaTerpopuler:BharadaESudahBicara,CampurTanganFerdySamboTerungkap,MasihAdaKejutanLainKolumniskondangDahlanIskanpunpenasarandenganmotifdibalikkasuspembunuhanYosuaHutabarataliasBrigadirJdirumahmantanKadivPropamPolriIrjenFerdySambo.MelaluitulisanberjudulMendungUdandikolomDisway,DahlanmulanyamenyinggungtentangskenariopelecehanseksualhinggasoalhubungancintaBrigadirJdengansangkekasihVeraSimanjuntak.DiapunmempertanyakanapakahistriFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.BacaJuga:5BeritaTerpopuler:IrjenFadilImranBicaradenganPresiden,PasukanBrimobBergerak,AdaTumbalpadaKasusBrigadirJ?Bacaselengkapnya,kliklinkdibawah:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarRezaIndragiri.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenilaipemunculanistriIrjenFerdySambo,PutriCandrawathidiMakoBrimob,KelapaDua,Depok,Minggu(7/8)sebagaiproblematik.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalituterkaitbenartidaknyaterjadikejahatanseksualolehBrigadirJterhadapPutriCandrawathidirumahdinasmantanKadivPropamPolri,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.PutriCandrawathi(kanan)didepanMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianBacaJuga:DahlanIskanSinggungSkenarioPelecehanSeksualPutriCandrawathidanUrusanCintaRezamengatakandariseluruhkorbankecelakaanlalulintas,15persenmengalamiguncanganjiwa.Sementaraitu,dalamkasuskejahatanseksual,korbanyangterguncangberatmencapai80persen.Satudatainisajasudahmenunjukkankeseriusankejahatanseksual.Korbansudahsepatutnyaditolong.Hak-haknyadipenuhi,ucapRezakepadaJPNN.com,Senin(8/8).BacaJuga:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarAkantetapi,lanjutReza,apakahdalamkasusDurenTigabenar-benaradakejahatanseksual?Tentuperlumenungguhasilinvestigasikepolisian.Namun,RezamelihatadayangproblematikdaripemunculanistriFerdySambodidepanmediaketikamendatangiMakoBrimob.TerlebihPutridisebut-sebuttelahmengalamipelecehanseksual.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-SuratIzinMengemudi(SIM)memilikimasaberlakuselama5tahunsetelahdibuat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});UntukandayangberdomisilidiJakartadaninginmemperpanjangdokumentersebut,DirektoratLaluLintasPoldaMetroJayamenyediakanlayananSIMKeliling.Dilansirdariakunresmi@TMCPoldaMetrodiInstagram,pihakPMJmenyiapkan5gerailayananSIMyangtersebardi4wilayahkotaDKIJakarta,Selasa(9/7).BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaPusatbisamemperpanjangSIMdiKantorPosLapanganBanteng.Kemudian,wargayangtinggaldiwilayahJakartaBaratpelayananSIMkelilingdibukadiLTCGlodokdanMallCitraland.BagiyangberdomisilidiJakartaSelatanbisamengaksesSIMkelilingdiKampusTrilogiKalibata.BacaJuga:LokasiLayananSIMKelilingdiJakartaHariIni,Ada5GeraiTerakhir,wargaJakartaTimurbisamenujukeGrandMallCakung.LayananSIMKelilinginiberoperasimulaipukul08.00hinggapukul14.00WIB.

SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.

DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.

KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.

cara menang main slot fire 88-🎖️pk88 login|XOXE88.COM

AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.

Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenteriKoordinatorBidangPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDinginagarBhayangkaraDuaRichardEliezeratauBharadaEmendapatperlindungan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudmendorongPolriagarmemfasilitasiLembagaPerlindunganSaksidanKorban(LPSK)untukmemberikanperlindungankepadaBharadaE.Melaluimimbarini,sayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberikanperlindungankepadaBharadaE,agardiaselamatdaripenganiayaanatauapapun,sehinggapendampingandariLPSKitudiaturdengansedemikianrupaagarnantiBharadaEbisasampaikepengadilandanmemberikanketerangandipengadilan,kataMahfuddalamkonferensiperssebagaimanadipantaumelaluikanalYouTubeKemenkoPolhukamdiJakarta,Selasa.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanMahfudmengapresiasipengacaraBharadaE,yakniDeolipaYumarayangmengomunikasikansecarabaikmengenaihal-halyangsebenarnyadialamiolehkliennya.Sebelumnya,Rabu(3/8),PolritelahmenetapkanBharadaEsebagaitersangkadalamkasuskematianBrigadirYoshuaHutabaratatauBrigadirJ.Sampaihariini,selainBharadaE,Polrijugatelahmenetapkanbeberapatersangkalainnya,yaituBripkaRR,KM,danmantanKadivPropamPolriIrjenFerdySambo.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuKeempatnyadisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.Dalamkesempatanyangsama,MahfudpunmengatakansegeramenyampaikankepadaPolriagarkeluargaBrigadirJdiberikanperlindungansecaraprofesional.Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.

KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!

cara menang main slot fire 88-🎖️pk88 login|XOXE88.COM

KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitraland

HotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaik 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.

IstriIrjenFerdySambo,PutriCandrawathi.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTASELATAN-PutriCandrawathi,istriIrjenFerdySamboturutmenyaksikansaatpenyidiktimkhusus(timsus)PolrimenggeledahrumahpribadinyadiRT07RW02JalanSaguling,KompleksPertambangan,DurenTiga,Pancoran,JakartaSelatan(Jaksel),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ketuarukuntanggasetempat,YosefmengatakanPutrihanyamenangisketikapenyidikmenggeledah.Iya,diamenangisterusdikamar,susahkamiberkomunikasi,kataYosefdikutipdariAntara,Rabu(10/8).BacaJuga:KPKBelumBisaUmumkanHartaKekayaanIrjenFerdySambo,AdaApa?YosefmengatakandirinyadimintaikuthadirdalamprosespenggeledahanbersamatimkhususpadaSelasa.KetikaitukeadaanPutriterlihatbaik-baiksajanamunpengacaramenyebutnyamenangisterusdidalamkamar.Yosefmengakumelihatadabeberapaorangyaknipengacara,polisiwanita(polwan),danBareskrimikutdalamprosespenggeledahanselamasembilanjam.BacaJuga:BenarkahPutriCandrawathiMengalamiPelecehanSeksual?IniKataKabareskrimAdajugakeduaanakFerdySambodanPutriyakniseoranganakperempuandananaklelakinyapalingkecilberumur1,5tahunbersamapengasuhnyajugaberadadidalamrumah.KeluargaFerdySambotinggaldirumahtersebutkuranglebihsetahunsehinggabelumterlalumengenalkawasanJalanSaguling.ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,KabupatenBekasi,JawaBarat,yangmerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.ANTARA/HO-PolresSerangjpnn.com,SERANG-ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,Bekasi,JawaBarat.DiadidugamerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.PelakuperampokanituberinisialIB(29)wargaBekasi,kataKapolresSerangAKBPYudhaSatriadiSerang,Rabu(10/8).PeristiwaperampokanterjadipadahariSabtu(6/8)pukul22.30WIB.Saatitu,tokobarututupdansejumlahkaryawansudahpulang.BacaJuga:4MalingMotorDiringkusPolisi,PengakuanMerekaMencengangkanPelakuyangmenggunakantopengdangolokitulangsungmenerobosmasuktokolewatpintubelakang.PelakumasukdanlangsungmenodongkangolokkekorbandanmengeluarkanplastikagarkorbanmemasukkanHPdanuang,kataYudha.PemiliktokoNH(41)pasrahmenghadapiancamanperampokyangakanmembacoknya,kemudianmenyerahkanuangRp100jutakedalamkantongplastik.Padasaatitu,pelakumemintakorbanagarmenyerahkanseluruhhandphone.Namunkorbanmenyebutkanbahwaseluruhponselsudahdimasukkankedalambrankas.Pelakuhanyamendapatkanuanglalukeluartokodanmenguncikorbandariluar,kataYudhaSatria.BacaJuga:PerampokBersenpidiApotekMedanAmbrukDiterjangTimahPanas,Bravo,PakPolisiPerampokBersenjatadiApotekDitembakPolisiDalammengungkapkasusitu,polisihanyamembutuhkanwaktuempathari.PolisimenangkapIBditempatkerjanya,Selasa(9/8).Darihasilpenggeledahan,kataYudha,petugasmengamankansejumlahbarangbukti,antaralainsatuunitHondaVario,duacincinemas,duaponsel,sertasejumlahalatuntukmerampok.(antara/jpnn)BeritaSelanjutnya:IdentitasPerampokyangMenewaskanSopirTaksiOnlineSudahDikantongi,Siap-SiapSaja

BekRealMadrid,DavidAlaba(jerseiputih)saatmelawanpemainEintrachtFrankfurt(jerseihitam)difinalUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridmenasbihkandirinyasebagaiRajaEropasetelahmempermalukanEintrachtFrankfurtdifinalUEFASuperCup2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Duagolyangmasing-masingdilesatkanolehDavidAlaba(37)danKarimBenzema(65)membawaMadridunggul2-0padalagayangdihelatdiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB.JalannyaPertandinganBacaJuga:PengamatMintaPSMMakassarWaspadaiKualaLumpurCityFC,IniPemicunyaMadridlangsungtancapgassejakmenitawal.JawaraLigaChampionsituterusmencecarpertahananFrankfurtselakukampiunLigaEuropa.Namun,Madridbarubisamembukakeunggulanpadamenit37.UmpandariCasemiromampudituntaskanmenjadigololehAlabasehinggapapanskorberubahmenjadi1-0hinggaturunminum.Dalamkeadaantertinggal,FrankfurtberupayauntukmenekanMadrid.Akantetapi,skortetaptidakberubah.ElRealtetapmemimpin1-0.BacaJuga:BawaIndonesiakeFinalPialaAFFU-162022,BimaSaktiKokMintaMaaf,AdaApa?Padababakkedua,Madridtampakmasihlebihmendominasi.FrankfurtmasihsajakesulitanmenembuspertahanananLosBlancosyangdikawalduetDavidAlabadanEderMilitao.Madridkemudianmenambahkeunggulannyamenit65.AsisstViniciusJuniordisambutdengansepakanmendatarolehKarimBenzemayangtakmampudihalaukiperFrankfurt,KevinTrapp.KuasahukumkeluargaBrigadirJatauNofryansahYosuaHutabarat,KamaruddinSimanjuntak(kanan)danJohnsonPanjaitandiBareskrimPolribeberapawaktuyanglalu.Foto:Ricardojpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangRabu(10/8)tentangsebuahmisterikepemilikansenjatauntukmembunuhBrigadirJterungkap,satudariempattersangkapembunuhanBrigadirJmuncul,hinggaperintahFerdySamboparah.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahBacaJuga:5BeritaTerpopuler:5PengakuanTerbaruBharadaETerungkap,LPSKMendadakBungkam,KomjenAgusMeresponsTegasMisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:5BeritaTerpopuler:BharadaELegaMembongkarKasusBrigadirJ,AdaRahasiaBesarhinggaUrusanCintaBacaselengkapnya,kliklinkdibawah:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,Parah

TersangkaMRsaatdiamankandiPolresRejangLebong.Foto:doklinggauposjpnn.com,REJANGLEBONG-JajaranPolresRejangLebongmembongkarkelakuanasliseorangkhatibmasjidberinisialMR(43)diBengkulu.MRyangselamainidikampungnyadikenalsebagaikhatibmasjidternyatapredatoranak.Korbannyaputrinyasendiri.BacaJuga:DiMasjidMRJadiKhatib,SampaidiRumahBerubahMonster,Biadab!BacaJuga:PerbuatanSopirAngkotIniSungguhBikinEmosiTingkatTinggiPriaparuhbayaituternyatatelahmelakukanhalpalingkejiterhadapanaknyasendiriyangmasihberusia9tahun.WargaRejangLebong,Bengkuluitumemerkosaanaknyasendiri,bahkanitusudahdilakukansejak2019lalu.PerbuatankejiterakhiryangdilakukanMRpadaSelasa(9/8)kemarin.BacaJuga:IstrinyaDigoda,MemedBacokAlpian,TempatPijatBanjirDarahAksibejatnyaitudiketahuitetanggasehinggasampaikemejaPolsekBermaniUlu,RejangLebong.KapolresRejangLebongAKBPTonnyKurniawanmenjelaskantersangkaditangkapberdasarakanlaporankorbandidampingitetangga.Sejumlahpersoneltampaksedangberbaris.Foto:Ricardo/JPNN.jpnn.com,JAKARTA-KepolisianRepublikIndonesia(Polri)memiliki434.135personelyangtersebardiseluruhwilayahnusantara.Setiappolisimemilikipangkatsesuaidenganseleksipendaftarandanberapalamamerekamengabdidikorpsbajucokelat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SistemkepangkataninisudahdiaturdalamPeraturanKapolriNomor3Tahun2016tentangAdministrasiKepangkatanAnggotaKepolisianRepublikIndonesiadalamBabIItentangGolonganKepangkatanPasal3.AdapunjenjangkepangkatanPolriterbagimenjaditiga,pertamaadatamtama,keduabintara,danketigaperwira.BacaJuga:31AnggotaPolisiMelanggarKodeEtikDalamPenangananKasusKematianBrigadirJ,ApakahAdadariKedokteranForensik?TamtamaDimulaidaripangkatterendahadapadajenjangtamtama.1.BhayangkaraDua(Bharada)Iniadalahpangkatterendahdikepolisianketikaseseoranglulusseleksipendaftarantamtamadansudahmenjalanipendidikan.BacaJuga:IniDaftarNama32PolisiBerprestasiPenerimaKenaikanPangkatLuarBiasadariKapolriBentukpangkatbharadainiadalahgarismiringsatu.2.BhayangkaraSatu(Bharatu)

ParapemainRealMadridsaatmerayakangelarUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridsuksesmenggondoltrofiUEFASuper2022setelahmenaklukkanEintrachtFrankfurt.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});BermaindiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB,ElRealunggul2-0atastimJermantersebut.DuagolkemenanganMadridlahirlewataksiDavidAlaba(37)danKarimBenzema(65).BacaJuga:UEFASuperCup2022:PermalukanFrankfurt,RealMadridRajaEropaRaihanpositifinitakterlepasdaripenampilangemilangsejumlahpenggawaElReal.Darisekianbanyaknama,adasetidaknyalimapemainyangpalingmenonjol.Siapasajamereka?Simakulasannyaberikutini.1.CasemiroGelandangasalBrasilinimenjadipemutusseranganFrankfurtsebelummenembuspertahananElReal.Total,Casemiromampumelakukansembilantekelsukses,duaintersep,dansatublok.BacaJuga:BosPSMMintaPerubahanJadwalPertandinganLiga1,IniPenyebabnyaTakcumaitu,CasemirojugaaktifmembantuseranganElRealdengancatatan54umpanakuratdari64percobaan.Takayal,WhoScoredmemberinyanilai8,6,yangtertinggidibandingpemainMadridlainnya.2.KarimBenzemaLagidanlagi,Benzemamembuktikanbahwadirinyabelumhabis.StrikergaekasalPrancisitumenunjukkankualitasnyasebagaifinisherulung.Kankerotak(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Penyebabkankerotakmasihbelumdiketahuisecarapasti.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Namun,terdapatbeberapafaktoryangdidugamembuatseseoranglebihrentanmengalamikankerotak,diantaranyaadanyamutasigenetik,riwayatkankerotakdalamkeluarga,usiatua,danpaparanradiasi.Makananternyatajugabisamenjadifaktorrisikokankerotak.Karenaitu,kitapatutwaspadaketikaakanmengonsumsimakanantertentu.BacaJuga:BenarkahEsBatuBisaMenyembuhkanAsamUrat?Marikenalijenis-jenismakananpenyebabkankerotakberikutini:1.AlkoholKonsumsialkoholberhubungandengantimbulnyabeberapajeniskanker,sepertikankermulut,kankernasofaring,kankeresofagus,kankerpayudara,hinggakankerotak.Risikokankerakanmeningkatapabiladosisalkoholyangdikonsumsiberlebihan,apalagidisertaikonsumsitembakau.BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?Olehkarenaitu,sebaiknyabatasikonsumsialkohol,bahkanbilaperluhindari.2.MakananyangBerjamurBeberapajenisjamur,salahsatunyaAspergillusflavus,mengandungmetabolitaflatoksin.JamurAspergillusflavusdapatmenjadiparasitpadakacang,pohonkacang,danbiji-bijian.IrjenFerdySamboditahandiMakoBrimob.Foto:Ricardo/JPNN.comjpnn.com,JAKARTASELATAN-Penyidiktimkhusus(timsus)PolrimelakukanpemeriksaanperdanaterhadapIrjenFerdySambosebagaitersangkakasusdugaanpembunuhanBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaanterhadapmantanKadivPropamitudilakukandiMakoBrimob,KelapaDua,Depok,hariini,Kamis(11/8).Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFSsebagaitersangkadiMakoBrimob,kataKadivHumasPolriIrjenDediPrasetyokepadawartawan.BacaJuga:KomnasHAMPeroleh5DataRekamanCCTVsoalPenembakandiRumahFerdySambo,Isinya?Selainitu,kataDedi,penyidiktimkhususjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri,JakartaSelatan.PemeriksaankeduadilakukankepadaKMsebagaitersangkadiBareskrim,ujarDedi.Secaraparalel,Dedimenyebut,pihakInspektoratKhusus(Irsus)PolrijugamenjadwalkanmelakukanpemeriksaanterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJayaterkaitkasuspenembakanBrigadirJ,padahariini.BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaDedimenyebutpemeriksaanitudilakukandiMabesPolri.SedangkanIrsus,agendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJaya,jam10.00WIBdiMabesPolri,ucapDedi.AudiensipengurusGLPGPPPKdenganSesditjenGTKKemendikbudristekNunukSuryani.Foto:DokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-Pemerintahberencanamenerbitkanpetunjukteknis(juknis)rekrutmenpegawaipemerintahdenganperjanjiankerja(PPPK)awalSeptember.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Namundemikian,gurululuspassinggrade(PG)PPPKjustrupesimistisjadwalpenerbitanjuknisituakanmolorlagi.KetuaForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimengungkapkanKementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)memangsudahmenginformasikanagarmenunggujuknisturun.BacaJuga:PemkabBogorAjukanPenambahanFormasiPPPK2022,PalingBanyakuntukGuruSekretarisDitjenGuruTenagaKependidikan(GTK)NunukSuryanibahkanjugamemintaparagurululusPGagartidakmempercayaidataExcelyangberisidaftarnamadanpenempatankarenasemuanyamenunggujuknis.Meskidemikian,kataIswadi,gurululusPGkhawatirjadwalpenerbitanjuknisitumoloraliastidaktepatwaktu.Jujursaja,kamipesimistisakantepatwaktu,karenamasihharusdirapatkandenganpihak-pihakterkait,terangIswadikepadaJPNN.com,Kamis(11/8).BacaJuga:THPGuruPPPKRp6Juta,PNSRp14Juta,KepalaBKNMerespons,BersyukurlahIswadidanrekan-rekannyamakingusarkarenasaatmerekabertanyakapanseleksiPPPK2022dibuka,tidakadajawabandantimelinejugatakdiberikan.Diamendugahalituterkaitdenganpendataanseluruhtenaganon-aparatursipilnegara(non-ASN)yangsementaraberjalandiseluruhdaerah.

PutriCandrawathi(kanan)diMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTA-KalimatyangkeluardarimulutPutriCandrawathikepadatimdariLembagaPerlindunganSaksidanKorban(LPSK),masihmenjaditandatanyabesar.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});TimLPSKsebelumnyamelakukanasesmenterhadapistrimantanKadivPropamPolriIrjenFerdySamboitudirumahJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.PutrimerupakansalahsatusaksikuncikasuspembunuhanberencanaterhadapYosuaHutabarataliasBrigadirJyangmelibatkanBharadaE.BacaJuga:IstriIrjenFerdySamboPutriCandrawathiKenapaMalu?EdwinTakTahuKonon,peristiwapembunuhanBrigadirJyangdidugadidalangiIrjenSambo,dipicudugaanpelecehanseksualterhadapPutri.MengacupenjelasanWakilKetuaLPSKEdwinPartogiPasaribu,Putrihanyamengucapkankata-katasingkat.Itupun,adasatukatayangdiulangduakaliolehPutri.BacaJuga:KomjenAgusTegaskanBharadaEMengakukarenaKegigihanPenyidikdanTimsus,BukanPengacaraYangterucaphanyaitu;Malu,Mbak.Malu,ucapEdwinPartogimenirukanmengungkapperkataanPutrikepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).Namun,EdwinmengakutidakpahamdengankatamaluyangdimaksudPutriCandrawathi.Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).IlustrasiFoto:Ricardo/JPNN.comjpnn.com,JAKARTA-Timkhusus(timsus)mengagendakanpemeriksaanterhadapIrjenFerdySambosebagaitersangkakasuspembunuhanBrigadirNofryansahYosuaHutabaratatauBrigadirJpadaKamis(11/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KepalaDivisiHubunganMasyarakat(KadivHumas)PolriIrjenDediPrasetyomengatakanpemeriksaanterhadapmantanKadivPropamPolriitudilakukandimarkasKomjenAnangRevandoko.Hariini,penyidiktimsusmelakukanpemeriksaanterhadapIrjenFS(FerdySambo,red)sebagaitersangkadiMakoBrimob,kataDedidalamketerangannya,Kamis(11/8).BacaJuga:HotmanParisMenyindirIstriIrjenFerdySambo,BeginiKatanyaJenderalbintangduaitumengatakantimsusjugamelakukanpemeriksaanterhadaptersangkalainnyayakni,KMdiGedungBareskrimPolri.PemeriksaanjugadilakukankepadaKMsebagaitersangkadiBareskrimPolri,kataDedi.Disisilain,InspektoratKhusus(itsus)PolrijugamenjadwalkanpemeriksaanetikterhadapsatuorangpenyidikyangbertugasdiPoldaMetroJaya.BacaJuga:5BeritaTerpopuler:MotifPembunuhanBerencanaBrigadirJTerungkap,1dari4TersangkaMuncul,FerdySamboTernyataPemeriksaandilakukandiMabesPolri.ItsusagendanyapadahariinimelakukanpemeriksaankepadasatuorangpenyidikPoldaMetroJayapukul10.00WIBdiMabesPolri,tuturDedi.

AjudanIrjenFerdySambo,BhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNNjpnn.com,JAKARTA-KetuaIndonesiaPoliceWatch(IPW)SugengTeguhSantosomendukunglangkahKapolriJenderalListyoSigitPrabowoterkaitpenanganankasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KasusituinisemuanyaditanganiBareskrimPolri,mulaidarikasuskematian,dugaanpembunuhanberencanaterhadapBrigadirJ.KemudiandugaanpelecehandanancamanpembunuhanyangdialamiPutriCandrawathi,istriIrjenFerdySambo.MenurutSugeng,sudahsaatnyaPolrimenjeladlankepadapublikapayangsebenarnyaterjadidalaminsidenbakutembakdirumahIrjenFerdySamboitu.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanSugengmenyebuthalituperlukarenaBrigadirJdanBharadaEbukanyangsebatasajudanIrjenFerdySambo.KeduapolisiitumerupakananggotaSatuanTugasKhusus(Satgassus)PolribentukanKapolri.DaripenelusuranIPW,BrigadirJyangtewasditembakmerupakananggotasatgassus.LaluBharadaRichardEliezerjugaanggotasatgassus,kataSugeng.BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolKemudianinsidenberdarahiniterjadidirumahdinasIrjenFerdySamboyangjugasebagaiKetuaSatgassusPolritersebut.Olehsebabitu,KapolriharustegasmenanganikasusinisesuaiperintahPresidenJokowiuntukdiproseshukum,terbuka,danjanganditutup-tutupi,ujarSugeng.PenampakanpesawatelektrikEHang216yangberencanadioperasikansebagaitransportasiumumdiIndonesia.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengusahaRudiSalimberencanamembangunbisnistaksiterbangdiIndonesia.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});SahabatRaffiAhmaditubakalmenjadikanpesawatelektrikEhang216sebagaitaksiterbang.LantasberapasebenarnyahargaEhang216?BacaJuga:BamsoetDukungPengadaanEHang216sebagaiOfficialAircraftIMIRudiSalimengganblak-blakanmengenaihargaasliEhang216.Namun,diamembuatperumpamaanterkaithaltersebut.Kisaranlebihmurahdarisupercar,deh,pokoknya,kataRudiSalimsaatditemuidikawasanKemayoran,JakartaPusat,Minggu(31/7).RudiSalimmengatakanbiayaperawatanEhang216jugatergolonglebihmurahdaripadapesawatkonvensional.BacaJuga:RudiSalimBerencanaBangunBisnisTaksiTerbangdiIndonesiaSebab,Ehang216beroperasimenggunakandayalistrik.Tenagalistrikyangdiperlukanuntuksatupesawateletrikinijugadisebuttidakbesar.Jadi,sangataffordable,imbuhnya.

BhayangkaraDuaRichardEliezeratauBharadaEdikantorKomnasHAM,Jakarta,Selasa(26/7).Foto:Ricardojpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatinsidenpolisitembakpolisidirumahKadivPropamnonaktifIrjenFerdySamboternyatatelahkembalikekesatuanasalnya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalitudiungkapkanKepalaDivisiHumasPolriIrjenDediPrasetyodiJakarta,Minggu(31/7/2022).DiamenyebutkanalasanBharadaEkembalikeBrimobkarenayangbersangkutanmasihberstatussebagaisaksidalamkasuspolisitembakpolisi.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriYa,karenastatusnyamasihsebagaisaksi,kataDedi.IaengganmenjelaskanlebihdetailterkaitdenganalasanpenarikanBharadaEkeMakoBrimob.Sementaraitu,BharadaRichardEliezeratauBharadaEdiketahuisebagaianggotaBrimobyangdiperbantukandiDivisiPropamPolridanmenjadiajudanIrjenPol.FerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhBharadaEdidugaterlibatbakutembakdenganBrigadirNofriansyahYosuaHutabaratatauBrigadieJdirumahKadivPropamPolriIrjemPol.FerdySambodiDurenTiga,JakartaSelatan,Jumat(8/7).Kepolisianmenanganitigalaporandalamperistiwatersebut,yakni:pertama,laporanberkenaandengandugaanpelecehanseksualataupencabulan;kedua,berkenaandengandugaanpengancamandankekerasansertapercobaanpembunuhan.KapoldaMetroJayaIrjenFadilImran.Foto:DokumenJPNN.com/Ricardojpnn.com,JAKARTA-KabidHumasPoldaMetroJayaKombesEndraZulpanmengatakanpihaknyatelahmenghentikanpenyidikankasuspenyuntinganprofilKapoldaIrjenFadilImrandilamanWikipediasehinggamenjadihoaks.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Penghentiankasustersebutsesuaidengankeputusankapoldayangtelahmemaafkanpelaku.Kasusnyadihentikan,kataEndraZulpandiJakarta,Minggu.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuDiamenambahkanpelakuyangdiketahuibernamaNyomansaatinitidakdilakukanpenahanandantelahdipulangkankerumahnya.Iya,sudahdipulangkan,ujarZulpan.PelakudiketahuisebelumnyatelahbertemudenganIrjenFadilImran.BacaJuga:IdentitasPelakuPembunuhanMayatTerlilitLakbanTerungkap,DiaTernyataPertemuankeduanyaitujugadiabadikandalamunggahanmelaluiakunKapoldaMetroJayadiInstagram.Dariawalsayajugatidakpernahmelaporkan,tidakmerasasakithatisamasekalidenganeditan-editanNyomanitu,tidakada,kataFadilImrandalamunggahanvideotersebut.

PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.IlustrasiFoto:Ricardojpnn.com,JAKARTA-PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});JabatanitulalutetapdipakaiolehKapolriselanjutnyasampaisaatini.PembentukansatgasinidibuatsejakKapolridijabatJenderalTitoKarnavianhinggaberlanjutkepadaIdhamAzisdankiniListyoSigit,kataEdidalamketerangannya,Minggu(31/7).BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDirekturEksekutifLemkapiitumenerangkankasatgassushanyabisadifungsikanolehKapolrisewaktu-waktudiperlukan.Diamencontohkansatgasinidiperlukansaatadagangguanperekonomiannasional.Meskidemikian,menurutEdi,jabatankasatgasadalahposisitambahanpejabatKadivPropamPolri.BacaJuga:AutopsiBrigadirJDilaksanakanHariIni,KapolriBicarasoalTanggungJawabSaatjabatanKadivPropamPolridicabut,makadengansendirinyaposisikasatgassusotomatisakanhilang.DanhalituberlakuterhadapIrjenFerdySambo.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirekturEksekutifLemkapiEdiHasibuanmeragukanpendapatsejumlahpihakbahwaIrjenFerdySambobisamengintervensipenyidikankasuspenembakanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutEdi,penanggungjawabtimkhususyangdibentukKapolriJenderalListyoSigitPrabowoituialahWakapolriKomjenGatotEddyPramono.TanpamengurangirasahormatsayadenganFerdySambo,diatidakbisamenekanapalagiintervensidalamkasusini.ApalagiketuatimkhususPolrisendiriadalahWakapolriKomjenGatotyangnotabeneadalahjenderalbintangtiga,katadia.BacaJuga:LemkapiYakinFerdySamboSulitIntervensiPenyidikanPenembakanBrigadirJ,IniPenjelasannyaSelainWakapolri,timkhususjugadiisiIrwasumKomjenAgungBudiMaryoto,KabareskrimKomjenAgusAndrianto,danKabaintelkamKomjenAhmadDofiri.Jadi,logikanya,bagaimanamungkinjenderalbintangduatanpajabatanbisaintervensiWakapolri,Katadoktorilmuhukumitu.Edijugamenyampaikanbahwajabatankepalasatgaskhusus(Kasatgassus)yangdisandangIrjenFerdySambosudahmenghilangsetelahkedudukanyangbersangkutansebagaiKepalaDivisiPropamPolridinonaktifkan.BacaJuga:LemkapiAnggapPutusanPDTHBrotosenoPenuhiRasaKeadilanSaatjabatanKadivPropamPolridicabut,makadengansendirinyajabatanKasatgasyangdisandangnyaotomatisakanhilang,kataEdi.Menurutnya,jabatankasatgasmerupakanposisitambahanKadivPropamPolri.VerrellBramasta.Foto:Instagram/bramastavrljpnn.com,JAKARTA-AktorVerrellBramastadilarikankesalahsaturumahsakitbaru-baruini.Diaharusmenjalaniperawatanlantaranmengalamicederadibagianwajah.Akusekaranglagidirumahsakit,kemarinakujatuh,kataVerrelllBramastamelaluiakunmiliknyadiInstagram,Minggu(31/7).BacaJuga:CiumTangan,AldiTaherMintaMaafkepadaDinarCandyMantanpacarNatashaWilonaitumengakumengalamilukaaliasrobekdibagiandekatalis.VerrellBramastamenyebutlukatersebutakibatterbenturdenganfirehydrant.Akulukarobek,kenafirehydrant,jelaspemainsinetronPutriuntukPangeranitu.BacaJuga:SeringaiKembali,LaluSuarakanProtesuntukKominfoVerrellBramastaketakutanlantaranlukatersebutharusdijahitolehtenagamedis.Demimenghilangkanrasatakut,cowok25tahunitumemilihmelakukansiaranlangsungdiInstagram.Joshua,pembocordatarahasia.IlustrasiFoto:Antarajpnn.com,JAKARTA-KementerianKomunimasidanInformatika(Kemenkominfo)akhirnyabukasuaramengenaidatapenggunayangbisadilihatsetelahmendaftarkanpenyelenggarasistemelektronik(PSE).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});Diamenegaskantidalbisamelihatdatapenggunameskipunsudahmendaftarkan.Menurutdia,aksesdatapribadipenggunahanyabisadilakukanolehaparatpenegakhukumdaninstansiyangmemilikikewenangan.BacaJuga:KemenkominfoBlokirSejumlahPlatformLuarNegeri,SandiagaUno:TidakBisaSeenaknyaAktivitasitupunharusdalamkondisitertentu.Kamitidakbisamelihatdatapribadisepetipercakapan,kataDirekturJenderalAplikasiInformatika,Kominfo,SemuelAbrijaniPangerapan,dalamjumpapersvirtual,Minggu(31/7).MenurutSemuel,kondisiyangmembuatsebuahlembagabisamemintadatakepadaPSEantaralainadalahuntukmengungkapkejahatan.BacaJuga:KemenkominfoBlokirSteamHinggaOriginKarenaHalIni,Simak!DiamencontohkanPusatPelaporandanAnalisisTransaksiKeuangan(PPATK)bisamemintainformasikepadaPSEuntukmembuktikanpraktikpencucianuang.(Pihak)yangmemintadataharuspunyakewenangan.Kominfotidakuntukitu,kataSemuel.

KuasahukumkeluargaIrjenFerdySambo,ArmanHanis,menyangkanperlakuanpublikterhadapkliennya.DokInstagramKadivPropamPolri.jpnn.com,JAKARTA-KuasaHukumIstriIrjenFerdySambo,ArmanHanismengingatkanpublikdanmediabahwakliennyaadalahkorbantindakpidanakekerasanseksual.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Menurutdia,haltersebutkiniseolahtenggelamakibatberbagaiisuliaryangberkembangterkaitkematianBrigadirJ.Segalaisu-isuyangadamembuatdugaantindakpidanakekerasanseksualmalahmenjaditenggelam,padahalnegarayangkitacintaiinimenganutasaskemanusiaanyangadildanberadab,kataArmandalamketerangannyapadaMinggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataArmanmengatakansetiapperempuanrentanmenjadikorbanTPKS,bahkanseorangistrijenderalsekalipun.Diapunmengingatkansemuapihakbahwadalamkasuskekerasanseksual,perspektifkorbanharusdiutamakan.Bahwaapayangterjaditerhadapklienkamisaatiniharusdipercayaisampaiterbuktisebaliknya,jelasdia.BacaJuga:FerdySamboHanyaJenderalBintang2,TidakMungkinBisaMenekanKomjenGatotdkkOlehkarenanya,ArmanberharaptimkhususyangdibentukKapolriJenderalListyoSigitPrabowodapatmengungkapkasusinisecaratuntasdantransparan.HalitusebagaimanaperintahPresidenJokoWidodo(Jokowi),bahwakasusiniharusdiselesaikandanjanganadayangditutup-tutupi.AsnawiMangkualam(depan)saatmembelaAnsanGreeners.Foto:Facebook/AnsanGreenersFCjpnn.com,ANSAN-AsnawiMangkualamberhasilmelanjutkantrenpositifnyabersamaAnsanGreeners.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Terkini,diabarusajamencetakgolkeduanyabagitimberjulukTheGreenWolvestersebut.HalituterjadiketikaAnsanmenangtelak3-0atasJeonnamDragonsdiAnsanWaStadium,Minggu(31/7/2022),padalanjutanKLeague2ataukompetisikastakeduaLigaKorea.BacaJuga:TimBuluTangkisPersembahkanMedaliEmasPertamauntukIndonesiapadaAjangASEANParaGames2022AsnawimencetakgolpertamaAnsandilagaini,tepatnyamenit59,sedangkanduagolsisanyadibukukanolehbraceThiagoHenrique(68,72).Seusailaga,Asnawimengakupergantianpelatihturutmendongkrakpenampilannya.KepecayaandirinyameningkatsetelahAnsanGreenersdilatiholehLimJong-heon.BacaJuga:MenporaAmaliBicaraKesuksesanEkonomidiExpoUMKMASEANParaGames2022Pergantianpelatihturutberpengaruh(penampilannya,red).Sayamakinpercayadiridanmemangsayaakuikondisisayabelummaksimalpadaawalmusim,ucapAsnawiseusailaga.Sayakinimakinpercayadiriberkatkepercayaanyangdiberikanpelatih,imbuhnya.

NikitaMirzanikembalisindirNindyAyunda.Ilustrasi.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-AktrisNikitaMirzanikembalimenyindirpenyanyiNindyAyundadimediasosial.SindiranituterkaitprotesyangdilayangkanNindypadasalahsatumedia.Banyakomonglu,NindyAyunda,tulisNikitaMirzanimelaluiakunInstagramputranya,Azka,Minggu(31/7).BacaJuga:NikitaMirzaniKembaliSerangNindyAyundaGegaraMasalahIniPesohorkelahiran17Maret1986inijugamenyinggungsikapNindyyangselalumenghindariawakmedia.Makanyakalauketemumediajangankaburlu.Gilirandiberitakanmedia,ngamuk,lanjutNikita.Sebelumnya,NindyAyundamengunggahsebuahtangkapanlayarpemberitaandirinyayangbakaldijemputpaksapolisi.BacaJuga:BaimWongDaftarkanCitayamFashionWeekkeHAKI,NikitaMirzaniBerkomentarBeginiNindymelaluiakunnyadiInstagram,takterimadiberitakansepertiitudanmemberiperingatankemediatersebut.MantanistriAskaraParasadyHarsonoitupunmemintamediatersebutuntukmenurunkanpemberitaantersebut.MenporaZainudinAmali.Foto:HumasKemenporajpnn.com,SOLO-MenporaZainudinAmalimengungkapkanbahwapenyelenggaraanASEANParaGamesSolo2022merupakanbentukperhatianPresidenJokoWidodo(Jokowi)terhadapatlet-atletdifabel.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Pasalnya,ajanginisudahempattahunatauduakalisecaraberturut-turuttidakdiselenggarakan.ASEANParaGames2022seharusnyatuanrumahadalahVietnam.Namun,merekatidakbersediamenyelenggarakanajangolahragaparalimpiktingkatAsiaTenggaraini.BacaJuga:ApaAlasanPenarikanBharadaEkeMakoBrimob?IrjenDediJawabBeginiAwalnyabukankitatuanrumahnyatapiVietnam.Karenanegara-negaralaintidakbersediamenyelenggarakan,makaatasarahanBapakPresidenJokoWidodountukmengajukandirimenjadituanrumah,kataMenporaAmali.MenporaAmalipunmenjelaskanalasanJokowimemberiarahankepadadirinyauntukmengambilkesempatanmenjadituanrumahASEANParaGameskarenainiakanmenjadiajangbagiparaatletdifabeluntukberkompetisidalammeraihprestasi.Sebab,paraatletparagameskesempatannyauntukbertandingsangatterbatas,terlebihsejumlahajangmultieventharusditiadakandanditundasepertiASEANParaGamesFilipina2019,AseanParaGamesVietnam2022,danAsianGamesGuangzhouyangditundaketahun2023.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDisisilain,ajangsingleeventjugasangatterbatas.OlehkarenaituPakPresidenJokoWidodomemberiarahankepadasayauntukmemberimerekaarenauntukbertanding.BelumtentukalaukitatidakjadituanrumahASEANParaGames2022initerlaksana,katanya.

KadivHumasPolriIrjenDediPrasetyoakuiBHaradaEditarikkekesatuanBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatbakutembakyangmenewaskanBrigadirYosuaHutabarat(BrigadirJ)dirumahKadivPropamnonaktifPolriIrjenFerdySambo,ditarikkekesatuannya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidenbakutembakantaraBharadaEdenganBrigadirJkononterjadidirumahdinasIrjenFerdySambo,DurenTiga,JakartaSelatanpadaJumat(8/7).KepalaDivisiHumasPolriIrjenDediPrasetyopunmengakuipenarikanBharadaEkekesatuanbrigademobil(Brimob).BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolYa,karenastatusnyamasihsebagaisaksi,kataIrjenDedidiJakartapadaMinggu(31/7).Namun,jenderalbintangduaitutidakmemerincialasankesatuanmenarikBharadaE.BharadaEliezeratauBharadaEmerupakananggotaBrimobyangdiperbantukansebagaiaidedecamp(ADC)atauajudanIrjenFerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhAnggotaBrimobitubelakanganmenyitaperhatianpubliksetelahdisebutpolisiterlibatbakutembakdenganBrigadirJ.PolisimenyebutbakutembakitudipicudugaanpelecehanseksualdanpenodonganpistololehBrigadirJterhadapistriFerdySambo,PutriCandrawathi.KadivHumasPolriIrjenDediPrasetyodiMabesPolri,Jakarta,Rabu(20/7).Foto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeratauEditarikdarijabatanajudanIrjenFerdySambomenjadianggotaKorpsBrimobPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KabarpenarikanBharadaEkeKorpsBrimobinidibenarkanolehKadivHumasPolriIrjenDediPrasetyo.Ya(ditarikkeBrimob),karenastatusnyamasihsebagaisaksi,kataDedikepadawartawan,Minggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataSosokBharadaEdiketahuiikutterseretdalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.BharadEdisebutsebagaipenembakBrigadirJdirumahdinasIrjenFerdySambo.PenarikankeKorpsBrimobinidilakukanditengahprosespenanganankasuskematianBrigadirJmasihberjalan.BacaJuga:LawyerKeluargaSambo:IstriJenderalJugaBisaJadiKorbanPelecehanDedipuntidakmemerinciapaasalanutamaBharadaEditarikdariajudanIrjenFerdySambo.AdapunbakutembakantaraBharadaEdenganBrigadirJterjadidirumahdinasIrjenFerdySambodiDurenTiga,KecamatanPancoran,JakartaSelatan,Jumat(8/7).

Iklan Bawah Artikel