play666 apk download-๐ŸŽ–๏ธplay666 apk download|XOXE88.COM

blackjack 21 free ้™ˆๆŸๅฎ‡
2022-08-11 06:43:04

DesaWisataHijauPasarPancingan,DesaBilebante,KecamatanPringgarata,LombokTengah.Foto:Edi/Jpnn.comjpnn.com,LOMBOKTENGAH-DesaWisataHijauPasarPancingan,DesaBilebante,KecamatanPringgarata,LombokTengah,merupakansalahsatutamanwisatayangcukupmenarikuntukdikujungi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113234782-0);});Selaindapatmenikmatikeindahansuasanayangdisajikan,pengunjungjugabisamengabadikanmomenkarenadisanabanyakspotfotoyangkeren.KeindahanalamDesplay666 apk downloadaWisataHijauBilebantememangtidakdiragukanlagi.Halitumembuatdesainiterusberbenahmengembangkansektorpariwisata.BacaJuga:MengopidiLerengGunungMerapi,GanjarPranowoAmatiPotensiDesaWisataTamanwisatainijugabanyakdiminatiolehanak-anakkarenauntuksekadarmandiatauberkelilingmenggunakanATVdisekitarkolamrenangnya.Pasarpancinganiniadalahsalahsatuobjekwisatakita,dimanakamibukasetiapharimunggudarijam07:30sampaijam17:00sore,kataDirekturPokdarwisDesaBilebante,PahrulAzimkepadaJPNN.com,sabtu(6/8).Selainitu,PasarPancinganDesaBilebanteinijugamenawarkanbeberapajeniskulinerkhasBilebanteLombokyangsangatjarangditemukanditempatwisatayanglain.BacaJuga:SandiagaSebutSwastaBantuDesaWisataKembangkanPariwisataBerkualitasKamipunyamakanankhasayammerangkak,yangdibanderoldenganberbagaiharga.MulaidariRp60ribusampaiRp120ribuuntukduaorang,imbuhnya.Pahrulmengatakanuntukjaraktempuhnyasendiri,TamanWisataHijauinidapatdikunjungidenganjaraktempuh1,5jamdariKawasanMandalika.

DewiPerssikbersamaAnggaWijaya.FotoInstagram/dewiperssikrealjpnn.com,JAKARTA-PenyanyidangdutDewiPerssikmembongkarsalahsaturahasiasaatmasihberumahtanggadenganAnggaWijaya.Selama5tahunmenikah,diamengakutidakpernahmengharapkannafkahdariAnggaWijaya.Akutuhselamainitidakpernahmenuntutsuamiakuuntukmenafkahi,kataDewiPerssikdalamprogramPagi-pagiAmbyardiTransTV,Selasa(2/8).BacaJuga:DennyDarkoMeramalSiapaJodohDewiPerssikBerikutnya,BikinKagetPelantunMimpiManisitutidakmasalahmeskiAnggaWijayatidakmemberinafkah.Akantetapi,DewiPerssikmurkaketikamengetahuibahwaAnggaWijayayangselamainijadimanajernyadidugamenyelewengkanuang.Didugabanyakpenyelewengankeuangan,yangdiambilselamaini,denganbukti-bukti,tegasDepe,sapaannya.BacaJuga:JerinxSIDBebas,SupermanIsDeadKembaliUtuhOlehsebabitu,DewiPerssiktetaplegawameskiharusberceraidariAnggaWijaya.DewiPerssikkembaliberstatusjandasetelahmajelishakimPengadilanAgama(PA)JakartaSelatanmengabulkangugatanceraiAnggaWijayaterhadapdirinya.KuasahukumkeluargaBrigadirJ,KamaruddinSimanjuntak.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTASELATAN-KamaruddinSimanjuntakselakukuasahukumkeluargaBrigadirJatauNofriansyahYoshuaSimanjuntakmengakuinginbertemudenganPutriCandrawathi,istriIrjenFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0)play666 apk download;});Kamaruddinpenginbertemuuntukmenanyakanlangsungsoaldugaanpelecehanseksualyangdialamiistrijenderalpolisibintangduaitu.Sayainginberbicaradengandiasupayajelasapayangterjadipada8Juli2022(harikematianBrigadirJ),katadiakepadawartawandiBareskrimPolri,JakartaSelatan,Selasa(2/8).BacaJuga:KamaruddinBicaraSoalPosisiOtakBrigadirJ,KomnasHAMMenanggapiBeginiPriakelahiranSumateraUtaraitumengatakanpertemuaninitentunyabermaksuduntukmengurangimisteriyangmasihbelumterungkap.KamaruddinmenyebuthaltersebutdilakukanagarkasusinicepatterungkapdantidakmembebaniPolri.Jadi,sayatertarikuntukbertemuIbuPutrisupayatahudanmengurangiterlalubanyakmisalnyamisteriyangtidakterungkap,ujarnya.BacaJuga:IstriFerdySamboDilecehkan,KamaruddinSebutBrigadirJTakBisaDimintaiPertanggungjawabanNamun,KamaruddinengganmemaksakandiribertemuPutri.Sebab,halinitergantungdariPutri,apakahmauatautidak.SayamenawarkandiriuntukbertemuIbuPutri.Sayaberjanjiakanmelindungidiasecarahukum,kalauberkenanya,kataKamaruddin.

play666 apk download-๐ŸŽ–๏ธplay666 apk download|XOXE88.COM

DennyDarko.Foto:YouTube/DennyDarkojpnn.com,JAKARTA-PesulapsekaligusahlitarotDennyDarkomeramalkarierAnggaWijayayangtelahberceraidariDewiPerssik.DiamengatakanbahwaAnggaWijayabakalmencobamunculdaneksisdiduniahiburan.AnggaWijayabiasanyadibelakanglayar,akanmuncul,kataDennyDarkodalamvlogmiliknyadiYouTube,Selasa(2/8).BacaJuga:RamalanDennyDarkoSoalJodohDewiPerssikBerikutnya,OrangAkanKagetPeramalberusia45tahunitumenyebutAnggaWijayasudahmenyiapkanlangkahuntukkembalimasukduniahiburan.Meskidahuludikenalberkatsinetron,AnggaWijayakinimencobaperuntungansebagaipenyanyi.AnggaWijayamencobaperuntungandenganmengeluarkansinglebaru,jelasDennyDarko.BacaJuga:BebasdariTahanan,JerinxSIDSampaikanSebuahPengumumanMajelishakimPengadilanAgama(PA)JakartaSelatanmengabulkangugatanceraiAnggaWijayaterhadapDewiPerssik.AdapunDewiPerssikdanAnggaWijayakompaktidakhadirdalamsidangpembacaanputusanpadaSenin(8/1).Pergerakanrupiahhariinimasihcukupbaikkarenadidukungbaiksentimendaridalamnegerimaupunsentimenglobal.Ilustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-Nilaitukarrupiahhariini,Rabupagi(3/8)dibukamelemahdelapanpoinatau0,05persenkeposisiRp14.897perUSD.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});Kursrupiahhariinimelemahlantaranpasarmenunggurilisdatapertumbuhanekonomipadaakhirpekan.AdapunsebelumnyamatauangGarudaditutupRp14.889perUSD.BacaJuga:ByeUSD!RupiahHariIniMakinBerjayaPasarmasihmenunggupublikasidataPDByangakandirilisJumatbesok,yangkamiperkirakanakantumbuhcukuptinggi,lebihbaikdarikuartalI2022,kataEkonomSeniorMiraeAssetSekuritasRullyAryaWisnubrotosaatdihubungidiJakarta,Rabu.BadanPusatStatistik(BPS)mencatatperekonomianIndonesiapadakuartalI2022tumbuhtinggi5,01persenjikadibandingkandenganperiodeyangsamatahunlalu(year-on-year/yoy)karenapulihnyaaktivitasekonomimasyarakat.PadakuartalIV2021perekonomianIndonesiajugaberhasiltumbuh5,02persen(yoy)setelahpadakuartalIIIsangattertekanakibatmerebaknyapandemiCOVID-19varianDeltayanghinggamenyebabkangelombangkedua.BacaJuga:AliranModalAsingMasukTriliunanRupiahPekanIniDisisilain,lanjutRully,USDsaatinicenderungmasihmelemahterhadapmatauangnegara-negaralain.PelemahanUSDemangmasihdipengaruhiolehekspektasikenaikansukubungayanglessaggresiveolehTheFed(banksentralAS),ujarRully.ProsessidangAKPRustamdiMapoldaPapua.Foto:BripkaAndiforJPNN.comjpnn.com,JAYAPURA-EksKomandanKompiBrimobYonDWamenaJayawijayaAKPRustamdipecatsecaratidakhormatdarianggotaPolri.AKPRustamterbuktimelakukanpelanggaranberatdankodeetikkepolisian.Pemberhentiantidakdenganhormat(PTDH)AKPRustamdibacakandalamsidangkomisikodeetikprofesiPolri.BacaJuga:PengacaraIstriFerdySamboNgototLaporkanBrigadirJAtasDugaanPencabulan,PengalihanIsu?Hasilputusan(SidangKomisiKodeEtikProfesiPolri)AKPR(Rustam)telahterbuktimelakukanpelanggarankodeetikprofesiPolridanmendapatkanputusansanksiberuparekomedasiPTDH,tegasKabidPropamPoldaPapuaKombesPolGustavRUrbinasdilansirpapua.jpnn.com,Selasa(2/8).AKPRustamdisangkakanmelanggarPasal5Ayat(1)hurufCdanlsertaPasal10Ayat(1)hurufaPerpolNomor7Tahun2022.YangbersangkutanmenyalahgunakankewenangandalampenggunaansenjataapiyangmengakibatkanduapucuksenpihilangataudirampasolehOTKdansatuanggotabernamaDiegoRumaropenmeninggaldunia,ujarGustav.BacaJuga:BrigjenTNISembiring:SayaAkanBertanggungJawabBilaAdaPrajurityangTerlibatMenurutnya,rekomemdasiPTDHitusebagaibuktibahwaPoldaPapuasangattegasdalampembinaanpersonelyangmelakukanpelanggaran.InibagiankomitmendaribapakkapoldadalammenegakkanaturansertaperwujudandaritransparansiberkeadilansehinggadalamsidanginijugadihadirkanperwakilamkeluargakorbanBripdaDiegoRumaropenuntukmenyaksikansidangsecaralangsung,ujarGustav.play666 apk downloadPedangdutDewiPerssik.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PedangdutDewiPerssiksudahtigakaligagalberumahtangga.Meskibegitu,pelantunHikayatCintaitutaktakutuntukmencaripasanganlagi.Enggaklah,sayaharustetapjadiorangbaik,berprasangkabaik,ujarDewiPerssikdikawasanTendean,JakartaSelatan,Selasa(2/8).BacaJuga:BolehkahBerhubunganBadanSaatSedangInfeksiSaluranKemih?MantanistriAnggaWijayaitutaklagingoyodalammenemukanpasanganhiduplagi.DewiPerssikmengakubakallebihberpasrahkepadaTuhan.Cumamungkinmengalirsajalah,tuturnya.MantanistriSaipulJamilitutakberaniuntukmenaruhharaplagi.Olehkarenaitu,diamempercayakanseluruhnyakepadaTuhan.BacaJuga:MerasaDapatTekananMenikahdenganDewiPerssik,AnggaWijaya:NengTidakBahagiaSamaSayaBongkarPermasalahandenganAnggaWijaya,DewiPerssik:UangHilangMeluluAkuikutinskenarioAllahsaja,enggakberaniberharapjuga,kataDewiPerssik.(mcr7/jpnn)VideoTerpopulerHariini:UnggahanMenkoPolhukamMahfudMD.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmengakuibahwanarasidimediatentangtewasnyaNofryansahYosuaHutabaratatauBrigadirJtidakpernahkendurdanterusmenghadirkanketegangan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PolemikdimediatentangtrageditewasnyaBrigadirJmenegangkan,ujarmantanKetuaMKitumelaluiTwitterdiakun@mohmahfudmdsepertiyangdikutip,Rabu(3/8).Namun,kataMahfud,adasedikitpernyataandaripengacarakeluargaBrigadirJyangmembuatsuasanapengungkapantewasnyaanggotaBrimobitutidakterustegang.BacaJuga:JikaKasusBrigadirJTakTuntas,PolisiLainBisaBernasibSama,DiekseksusiTanpaAdaPengadilanUtamanya,katadia,saatpengacaraberbicaratentangkamerapengintaiatauclosedcircuittelevisionatauCCTVyangsempatrusakkarenadisambarpetir.SaatpengacarakeluargaBirigadirJbilang,kemarinkatanyaCCTVdisambarpetir,sekarangbilangCCTVada.Seharusnyapetirnyadiperiksajuga.Logikapublikcerdas,ujarMahfud.BrigadirJsebelumnyadisebutpolisitewasdalamsebuahinsidenbakutembakdenganBharadaEdirumahdinasKadivPropamnonaktifPolriIrjenFerdySambodiJakartaSelatan,Jumat(8/7)kemarin.BacaJuga:KubuPutriBuatLaporanDugaanPencabulanBrigadirJ,KamaruddinBeriJawabanMenohokBrigadirJtewasditempatdalambakutembakkarenaterkenabeberapapeluru,sedangkanBharadaEdiamankankepolisianpascaperistiwa.Klaimkepolisian,kasusbakutembakbermuladaridugaanpelecehanseksualolehBrigadirJkepadaPutriCandrawathi,istriIrjenFerdySambo.

TimnasU-16IndonesiasaatberlagadiPialaAFFU-162022.Foto:AseanFootball.jpnn.com,YOGYAKARTA-TimnasU-16IndonesiaberhasilmencuritigapoinsaatjumpaSingapurapadalanjutanGrupAPialaAFFU-162022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});BerlagadiStadionMaguwoharjo,Sleman,Rabu(3/8/2022),armadaBimaSaktimenangsembilangoltanpabalas.KemenanganiniturutberimbasterhadapVietnamyangdilagasebelumnyamenang5-0atasFilipina.Pasalnya,IndonesiaberhasilmenggusurtimberjulukTheGoldenStaritudaripuncakklasemenGrupA.BacaJuga:RibuanSuporterDukungTimnasU-16IndonesiavsSingapura,IniInfoTiketnyaTambahansembilangolmembuatIndonesiamemilikiproduktivitias+11,unggulduagoldariVietnam(+9).HasilinijugasangatpentingbagiArkhanKakadankawan-kawanuntukmenjagaasaloloskesemifinalPialaAFFU-162022.Sebab,hanyajuaragrupdantigarunnerupterbaikyangberhakloloskefaseberikutnya.BacaJuga:MabukdanMenabrakOrangHinggaTewas,BekPalmeirasLangsungDipecatDebutAnehKiperMudaAtleticoMadrid,DipaksaJadiStriker,KokBisa?NabilAsyuramenjadipemainpalingbersinardilagainidengantorehanhattrickpadamenit3,18,dan30.Selainitu,adaKafiaturRizkyyangmengemasbrace(35,43).Adapuntigagollainnyamasing-masingdibukukanolehHanifRamadhan(20),RiskyAfrisal(59),danIKomangAgus(90+1).(mcr15/jpnn)SuamiDewiPerssik,AnggaWijaya.ilustrasiFoto:FirdaJunita/JPNN.comjpnn.com,MAMPANG-SelebritasAnggaWijayadikabarkanjatuhmiskinsetelahberceraidariDewiPerssik.Mantanpegawaibankinitaklagitinggaldirumahmewah,melainkandikos-kosan.Akusekarangtinggaldikos-kosan,sendiridisana.Buatakupribadiitucukup,kataAnggaWijaya,dikawasanMampangPrapatan,JakartaSelatan.BacaJuga:IniAlasanAnggaWijayaPalsukanTandaTanganDewiPerssik,OalahDiapunmengakutetapbersyukurmeskikondisikehidupannyajauhberbedasaatmasihmenikah.Ngapainmewah-mewahan?Biayanya,kan,besar,tuturAnggaWijaya.PriayangtengahmerintiskarierdiduniahiburaninimengakuiikutmenikmatikemewahandariDewiPerssik.BacaJuga:DewiPerssikSiapkanMobilMewahuntukAnggaWijaya,Tetapi...Semuanyapunyadia,akuhanyaikutmenikmatifasilitasdiasaja,tetapienggakikutmemiliki,tuturnya.MenurutAngga,rumah,mobil,danfasilitasmewahlainnyaitusemuamiliksangmantan.SkuadPSMMakassardalamsebuahlagadiLiga12022/23.Foto:LigaIndonesiaBaru.jpnn.com,MAKASSAR-PSMMakassarakanmenjamuKedahFCpadasemifinalAFCCup2022zonaASEAN.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});PertandinganiniakanberlangsungdiStadionKaptenIWayanDipta,GianyarBali,Selasa(9/8/2022).DuelPSMvsKedahFCdiprediksibakalketatsangsengit.Sebab,keduatimsama-samaberambisimerebutkemenanganagarloloskebabakberikutnya.BacaJuga:PelatihKedahFCTebarAncamankePSMMakassar,Sorot1PemainDalamlagaini,PSMmaupunKedahFCbakalmenurunkanskuadterbaiknya.Kamiakanbekerjaekstrakerasuntukmeraihkemenangan,kataPelatihPSMMakassar,BernardoTavares,Senin(8/8/2022)siang.TimtertuadiIndonesiaitukemungkinanmenurunkanEvertonNascimento,YakobSayuri,danRezkiEkadilinidepan.BacaJuga:SambutHUTke-77RI,PelatihPSMMakassarPunyaPesanPentinguntukSuporterKemudian,PSMbakalmengandalkanWiljanPluim,RasyidBakri,sertaArfanditengah.Sementaraitu,YuranFernandes,ErwinGutawa,YanceSayuri,danAgungMannanakanmenjagabentengpertahananPasukanRamang.Terakhir,RezaAryaPratamabakalmenjadipemainterakhirdibawahmistar.

PetugaspemadamkebakaranberjibakumemadamkanapiyangmembakarMazdaCX7.Foto:CuciHati/jpnn.comjpnn.com,ILIRBARAT-MobilSUVMazdaCX7nomorpolisiD1584IYwarnaputihterbakardiJalanHuluBalang,KelurahanDemangLebarDaun,KecamatanIlirBaratI,Palembang,Senin(8/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1600966010670-0);});PemilikmobilOscarFauzi(42),wargaJalanBankRayaII,KelurahanDemangLebarDaunmengungkapkankronologikejadianbermulasekitarpukul14.30WIBseusaimengisibahanbakarminyak(BBM)PertamaxdiSPBUJalanHuluBalang.SetelahmengisiBBMterdengarsuaraletusandaribandepankananmobil,kemudianmunculapi.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanOscarbersamaistridanketigaanaknyalangsungkeluardarimobiluntukmenyelamatkandiri.Jadi,awalmulaituadasuaraletusandaribandepankanan,kemudianapitiba-tibamuncul,sayabersamaistridanketigaanakkeluar,mobilpunmeledakdanterbakar,ungkapdia.Oscarmengakusebelumkejadiantidakadakejanggalandimobil.BacaJuga:SiswaSMPTewasDitusukdiSekolah,PelakunyaTakAdayangMenyangkaWaktuperjalanandarirumahtidakadatanda-tandakejanggalanapa-apa.Mobilinijugasebenarnyajarangdipakai,karenahabisbensinmakanyamaudiisi,jelasnya.SatuunitmobilPemadamKebakaran(Damkar)PemkotPalembangdidatangkanuntukmemadamkanapi.TunggalputriIndia,PusarlaV.Sindhu..Foto:BadmintonPhoto-BWFjpnn.com,BIRMINGHAM-IndiamemborongtigamedaliemasdariajangCommonwealthGames2022yangdihelatdiBirmingham,Inggris.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});TigawakilIndiayangsuksesnaikpodiumtertinggiantaralainLakshyaSen(tunggalputra),PusarlaV.Sindhu(tunggalputri),sertaChiragShetty/SatwiksairajRankireddy(gandaputra).LakshyaSenmerebutemasseusaimengalahkantunggaputraMalaysia,NgTzeYong.BacaJuga:AFCCup2022:PrediksiSusunanPemainPSMMakassarvsKedahFCPemainranking10duniaitumengalahkanTzeYonglewatpertarungantigagimdenganskor19-21,21-19,21-16.KemenanganSendiikutiolehrunnerupOlimpiadeRio2016,PusarlaV.Sindhu.KampiunSingaporeOpen2022itumenangdenganskor21-15,21-13atasMichelleLi(Kanada).SatulagiwakilIndiayangberjayadiCommonwealthGames2022ialahChiragShetty/SatwiksairajRankireddy.BacaJuga:CommonwealthGames2022:NgTzeYongMenggila,LeeChongWeiBeriPetuahPentingJawaraIndiaOpen2022itumengatasiperlawananwakiltuanrumahBenLane/SeanVendyduagimlangsung,21-15,21-13.Dengankemenanganini,Indiatercatatmembawapulangtigamedaliemasdarisektorperorangancaborbulutangkis.HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).FotoIlustrasi:Ricardo/JPNN.comjpnn.com,JAKARTA-HargaemashariinimenguatpadaakhirperdaganganSeninatauSelasapagiWIB,(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});InvestasisafeheavenberbalikmenguatdaripenurunanakhirpekanlaludanbertenggerdiataslevelpsikologisUSD1.800perounce.PenguatanhargaemasditopangolehgreenbackyanglebihlemahmenjelanglaporaninflasiutamaAmerikaSerikat.BacaJuga:HargaEmasPegadaian,Sabtu6Agustus2022,AntamdanUBSKompakNaikKontrakemaspalingaktifuntukpengirimanDesemberdidivisiComexNewYorkExchange,terdongkrakUSD14atau0,78persen,menjadiditutuppadaUSD1.805,20perounce.EmasberjangkaanjlokUSD15,7atau0,87persenmenjadiUSD1.791,20padaJumat(5/8),setelahmelonjakUSD30,5atau1,72persenmenjadiUSD1.806,90padaKamis(4/8).IndeksUSDyangmengukurgreenbackterhadapenammatauangutamalainnya,turun0,17persenmenjadi106,4360,karenainvestormenunggudatainflasiASyangakandirilispadaRabu(10/8),membuatemaslebihmurahbagipemegangmatauanglainnya.BacaJuga:HargaEmasHariIniMerosotTajam,AmbyarEmasjugamenemukandukungantambahandariimbalhasilobligasipemerintahASyangturundanpembalikankeuntunganawalpadasaham-sahamAS.JikaWallStreetdanaset-asetberisikotetapdalamtrenpasarbearish,makakitaharusmengabaikansinyalinidenganrisikokitasendiri,kataanalisekuitasStoneX,FawadRazaqzadadalamkomentarnyapadaSenin(8/8).PengacaraBharadaE,DeolipaYumaradanMuhammadBurhanuddindikantorLPSK,JakartaTimur,Senin(8/8).jpnn.com,JAKARTA-SelamatpagipembacasetiaJPNN.com,hariinikamisajikanberitaterpopulersepanjangSenin(8/8)tentangBharadaEmengakusudahlegakarenamembongkarkasusBrigadirJ,sementaraituDahlanIskanmenuliskanrahasiabesarsoalkasusBrigadirJ,hinggaselainpelecehanseksualDahlanjugamenuliskansoalurusancintaPutriCandrawathi.Simakselengkapnya!googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Janganlupaya,tetappakaimaskersaatbepergian,rutinmencucitangandanmenjagajarakkarenapandemiCovid-19belumberakhir.1.KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarBacaJuga:5BeritaTerpopuler:BharadaESudahBicara,CampurTanganFerdySamboTerungkap,MasihAdaKejutanLainKolumniskondangDahlanIskanpunpenasarandenganmotifdibalikkasuspembunuhanYosuaHutabarataliasBrigadirJdirumahmantanKadivPropamPolriIrjenFerdySambo.MelaluitulisanberjudulMendungUdandikolomDisway,DahlanmulanyamenyinggungtentangskenariopelecehanseksualhinggasoalhubungancintaBrigadirJdengansangkekasihVeraSimanjuntak.DiapunmempertanyakanapakahistriFerdySambo,PutriCandrawathiakankonsistendenganskenariodilecehkansecaraseksual.BacaJuga:5BeritaTerpopuler:IrjenFadilImranBicaradenganPresiden,PasukanBrimobBergerak,AdaTumbalpadaKasusBrigadirJ?Bacaselengkapnya,kliklinkdibawah:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesar

RezaIndragiri.IlustrasiFoto:AndikaKurniawan/JPNN.comjpnn.com,JAKARTA-PakarpsikologiforensikRezaIndragiriAmrielmenilaipemunculanistriIrjenFerdySambo,PutriCandrawathidiMakoBrimob,KelapaDua,Depok,Minggu(7/8)sebagaiproblematik.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalituterkaitbenartidaknyaterjadikejahatanseksualolehBrigadirJterhadapPutriCandrawathidirumahdinasmantanKadivPropamPolri,DurenTiga,JakartaSelatanpadaJumat(8/7)lalu.PutriCandrawathi(kanan)didepanMakoBrimob,KelapaDua,Depok,JawaBarat,Minggu(7/8).Foto:AntaraVideo-SumberVideoFachmyFebrianBacaJuga:DahlanIskanSinggungSkenarioPelecehanSeksualPutriCandrawathidanUrusanCintaRezamengatakandariseluruhkorbankecelakaanlalulintas,15persenmengalamiguncanganjiwa.Sementaraitu,dalamkasuskejahatanseksual,korbanyangterguncangberatmencapai80persen.Satudatainisajasudahmenunjukkankeseriusankejahatanseksual.Korbansudahsepatutnyaditolong.Hak-haknyadipenuhi,ucapRezakepadaJPNN.com,Senin(8/8).BacaJuga:KasusBrigadirJ,SelainSinggungUrusanCinta,DahlanIskanjugaMenulisRahasiaBesarAkantetapi,lanjutReza,apakahdalamkasusDurenTigabenar-benaradakejahatanseksual?Tentuperlumenungguhasilinvestigasikepolisian.Namun,RezamelihatadayangproblematikdaripemunculanistriFerdySambodidepanmediaketikamendatangiMakoBrimob.TerlebihPutridisebut-sebuttelahmengalamipelecehanseksual.PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-SuratIzinMengemudi(SIM)memilikimasaberlakuselama5tahunsetelahdibuat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});UntukandayangberdomisilidiJakartadaninginmemperpanjangdokumentersebut,DirektoratLaluLintasPoldaMetroJayamenyediakanlayananSIMKeliling.Dilansirdariakunresmi@TMCPoldaMetrodiInstagram,pihakPMJmenyiapkan5gerailayananSIMyangtersebardi4wilayahkotaDKIJakarta,Selasa(9/7).BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaPusatbisamemperpanjangSIMdiKantorPosLapanganBanteng.Kemudian,wargayangtinggaldiwilayahJakartaBaratpelayananSIMkelilingdibukadiLTCGlodokdanMallCitraland.BagiyangberdomisilidiJakartaSelatanbisamengaksesSIMkelilingdiKampusTrilogiKalibata.BacaJuga:LokasiLayananSIMKelilingdiJakartaHariIni,Ada5GeraiTerakhir,wargaJakartaTimurbisamenujukeGrandMallCakung.LayananSIMKelilinginiberoperasimulaipukul08.00hinggapukul14.00WIB.

play666 apk download-๐ŸŽ–๏ธplay666 apk download|XOXE88.COM

SejumlahajudandanpengurusrumahtanggaIrjenFerdySambosaatmenjalanipemeriksaandiKantorKomnasHAM,Jakarta,Senin(1/8).Foto:Ricardo/JPNNjpnn.com,JAKARTAPUSAT-BrigadirRickyRizalatauRRsudahditetapkansebagaitersangkadalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Denganadanyapenetapantersangkaini,terungkapdiasudahberbohongdalamkesaksiannyapadaKomnasHAMbeberapawaktulalu.Dalamketerangannya,BrigadirRickymengakutahuadabakutembakantaraBharadaEdanBrigadirJ.Namun,BrigadirRickyhanyabersembunyidibalikkulkas.BacaJuga:HariIniKapolriUmumkanTersangkaBaruKasusBrigadirJ,KomjenAgus:InsyaallahTuntasHalinijugasudahdiungkapkanolehKetuaKomnasHAMAhmadTaufanDamanik.RickymengatakandiabersembunyidibalikkulkaskanRickyyangbilang,bukansaya,sayakatakanayodiuji.SekarangpenyidikmenjadikandiatersangkaPasal340KUHP,pembunuhanberencanaitu,ujarTaufankatadiakepadawartawandiJakartaPusat,Senin(8/8).MenurutTaufan,kebohonganitumembuatmerekamenjaditidakmudahpercayadenganketeranganparaajudanIrjenFerdySambo.BacaJuga:BharadaEMengajukanDirijadiJCdiKasusKematianBrigadirJ,BeginiPenjelasanPengacaraApakahkalianpikirkamisudahlangsungpercaya?Kanenggak,ujarpriaberusia57tahunBareskrimPolrimenetapkanBrigadirRickyRizalsebagaitersangkadalampembunuhanBrigadirJ.DirekturTindakPidanaUmumBareskrimPolriBrigjenAndiRianDjajadi(berjaketcokelat).Foto:FransiskusAPratama/JPNN.comjpnn.com,JAKARTA-TimKhususPolritelahmenetapkanBrigadirRRatauRickyRizal,ajudanPutriCandrawathi,istriIrjenFerdySambo,sebagaitersangkadalamkasusdugaanpembunuhanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});DirekturTindakPidanaUmum(Dirtipidum)BareskrimPolriBrigjenAndiRianDjajadimenyebutkanalasanBrigadirRRsebagaitersangkakasuspolisitembakpolisiitu.Alasannya,duaalatbuktisudahcukupuntukmenetapkanstatusnyasebagaitersangka,kataBrigjenAndisaatdikonfirmasidiJakarta,Senin(8/8).BacaJuga:MabesPolriBanjirKaranganBunga,MasyarakatMintaKasusBrigadirJSegeraDituntaskanHanyasaja,Anditidakmemerinciduaalatbuktitersebutapasaja,danbagaimanaperanBrigadirRRdalamperistiwapenembakanyangmenewaskanBrigadirJatauNofriansyahYosuaHutabaratdirumahdinasKadivPropamPolridiKomplekPolriDurenTiga,JakartaSelatanpadaJumat(8/7).Itumateripenyidikan,bukanuntukpublikasi,ujarketuaTimPenyidikanTimKhususBareskrimPolriitu.Sebelumnya,penyidikBareskrimPolritelahmenahansopirdanajudanPutriCandrawathi,istriIrjenFerdySambo,berisinialBharadaREdanBrigadirRR.BharadaREadalahBharadaRichardEliezerPudihangLumiuatauBharadaEyangsudahditetapkansebagaitersangkadandilakukanpenahananpadaRabu(3/8).SedangkanBrigadirRRditahanmulaiMinggu(7/8)diRumahTahanan(Rutan)BareskrimPolri.BacaJuga:BrigadirRickyMengakuCumaMenyaksikanSebagianPeristiwa,KiniJadiTersangkaPembunuhanBerencanaBrigadirRRditersangkakandenganPasal340KUHPjunctoPasal338junctoPasal55danPasal56KUHP.PasaliniberbedadengansangkaanpasalterhadapBharadaE,yakniPasal338junctoPasal55danPasal56KUHP.Priamengalamimasalahejakulasidini(Ilustrasi).Foto:Ricardo/JPNN.comjpnn.com-Ejakulasidinimerupakanproseskeluarnyaspermayangterjadilebihcepatdariyangdiharapkansaatberhubunganseksual.Priadianggapmengalamiejakulasidinibilasetelahsatumenitpenetrasi,tidakbisamenundaejakulasisaatberhubunganseksual,danmerasafrustrasiatautertekansehinggarelatifmenghindarikeintimanseksual.Janganabaikankondisiejakulasidini,karenabisamengganggukelancaranhubunganintim.Sebagailangkahawal,cobalakukancaramengatasiejakulasidinisendiriberikutini:BacaJuga:BanyakPriaMudaMengeluhSudahEjakulasiDini,DokterBoykeBeriKiatBegini1.KomunikasikandenganPasanganSaatadamasalahejakulasidini,pasanganbisaterkenadampak.Tidakjarangiamenjadibingung,kesal,tidakpuas,dansebagainya.Komunikasikanlahmasalahejakulasidinidenganpasangan.Denganbegitu,masalahinidiharapkandapatbisasegerateratasidankeintimantetapterjaga.Seringkali,salahsatupenyebabejakulasidiniadalahmasalahdenganpasangan.Jikamasalahdapatdiselesaikan,diharapkanperformaseksualpunmembaik.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinya2.LakukanMasturbasiKemudian,caramengatasiejakulasidinisendiridirumahsecaraalamiadalahmasturbasi.Cobamasturbasi1-2jamsebelumberhubunganseksualdenganpasangan.3.LatihanSenamKegelAgartidakcepatkeluarsaatberhubungan,lakukansenamKegelsebagaicarauntukmengatasinya.PengacaraHotmanParismenyebutmasadepanBharadaEditentukansekarang.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParismenyinggungsoalmasadepanBharadaE,tersangkatewasnyaBrigadirJ.HaltersebutberkaitandenganstatusBharadaEsebagaisaksikuncidalamkasuskematianBrigadirJ.MenurutHotmanParis,keterangandanpengakuandariBharadaEsangatlahpentingdalammengungkapkasusitu.BacaJuga:SiapaTersangkaBaruKasusBrigadirJ?HotmanParis:MungkinIrjenatauBrigjenPolisiMasadepanmuditentukansekaranginikarenakalaukamubuatpengakuansejujurnyamakapenyidikakanterbantuuntukmengungkapkanfaktasebenarnya,ujarHotmanmelaluiakunnyadiInstagramdikutippadaSelasa(9/8).PengacarabergayaparlenteitumengingatkanbebanyangharusditanggungBharadaEjikatakmengungkapkasussecarakeseluruhan.Lagi-lagi,rivalRazmanNasutionitumenyinggungsoalmasadepan.BacaJuga:HotmanParis:BharadaE,SayaPunyaIndraKeenam,Segeralah...Ingat,kalaubebannyahanyadikamu,bayangkanberatnyahukumandanmasadepanmumasihpanjangadikku,ucapHotmanParis.Olehkarenaitu,diamengimbauagarBharadaEbisamembuatpengakuanjujurdanmengungkapaktor-aktordibalikkasuskematianBrigadirJ.

RumahpribadiFerdySamboyangtertutuprapatsaatPutriCandrawathimenjalanipemeriksaanolehLembagaPerlindunganSaksidanKorban(LPSK)diJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa(9/8).Foto:KennyKurniaPutra/JPNN.comjpnn.com,JAKARTA-IstriIrjenFerdySambo,PutriCandrawathimenjalaniassessmentpsikologisolehLembagaPerlindunganSaksidanKorban(LPSK),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PemeriksaandilakukandikediamanpribadiIrjenFerdySamboyangberadadiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan.DaripantauanJPNN.com,timLPSKtibadirumahpribadiFerdySambosekitarpukul10.20WIBmenaikimobilToyotaFortuner.BacaJuga:HotmanParis:Halo,BharadaE,KamuBisaSajaMerasaNyamandiTingkatPenyidikan,tetapiSekitar4orangdaritimLPSKlangsungmemasukirumahpribadiFerdySambo.RumahFerdySambosendiridikawalketatolehbeberapaorangyangmengenakanpakaiansipil.Sudahya,enggakenakdenganwarga(sekitar).Sayalelahmenjaga,menguruskaliansemua,katasalahsatuorangdenganpakaianpremankepadaawakmedia.BacaJuga:5PengakuanTerbaruBharadaE,ArahnyaSudahJelas,HariIniJenderalSigitUmumkanAktorPentingAwakmediayangberadadidepanrumahFerdySambotidakdiperbolehkanuntukmenunggudidepanrumahberlantai3itu.LPSKakanmemintaketeranganPutriCandrawathi,istrimantanKadivProvamPolriIrjenFerdySambo.KapolriJenderalListyoSigitPrabowomengumumkanIrjenFerdySambotersangkakasuspembunuhanBrigadirJ,diMabesPolri,Jakarta,Selasa(9/8).Foto:Ricardo/JPNNjpnn.com,JAKARTA-PemilikpistolyangdipakaiBhayangkaraDuaRichardEliezeraliasBharadaEmenembakNofryansahYosuaHutabarataliasBrigadirJterungkap.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});BrigadirJtewasdirumahdinasmantanKadivPropamPolriIrjenFerdySambo,KompleksDurenTiga,JakartaSelatanpadaJumat(8/7)lalu.KapolriJenderalListyoSigitPrabowomenyebutkanBharadaEmenembakBrigadirJatasperintahFerdySambo.BacaJuga:AnalisisRezaIndragiri:AdaPerbuatanBerulangDialamiPutriCandrawathi,BeginiSenakaapi(senpi)yangdipakaiBharadaEmenembakrekannyasesamaajudankadivpropamitumerupakanmilikBrigadirRickyRizalalisBrigadirRR.BrigadirRRjugatelahditetapkansebagaitersangkadalamkasuspembunuhanitu.PenembakanterhadapBrigadirJdilakukanatasperintahSaudaraFSdenganmenggunakansenjatamilikSaudaraBrigadirR,kataJenderalListyodiBareskrimPolri,Selasa(9/8).BacaJuga:IniPeranFerdySamboCsdiKasusPenembakanBrigadirJKendatidemikian,belumdiketahuiapakahIrjenFerdySambojugaikutmenembakkorban.TerkaitapakahFSikuttembak(menembakBrigadirJ,red),inisedangdilakukanpendalaman,ucapmantanKabareskrimPolriitu.TangkapanlayarMenteriKesehatanMalaysiaKhairyJamaluddinsaatmemberikanketeranganpersterkaitsituasikasusCOVID-19diMalaysiasecaradaringdiaksesdariKualaLumpur,Jumat(8/7/2022).Foto:ANTARA/VirnaPSetyorinijpnn.com,PUTRAJAYA-GelombangCOVID-19diMalaysiaakibatpenularansubvarianOmicronBA.5kecildanterkendali,kataMenteriKesehatanMalaysiaKhairyJamaluddin.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601043357086-0);});Iamengatakan,saatnegara-negaratertentumelaporkangelombangbesarOmicronBA.5,Malaysiamenghadapigelombangkeciltapiberkepanjangan.Sepertiyangsayakatakansebelumnya,(pergerakandari)2.000menjadi5.000kasusmemakanwaktucukuplama.Tidakadapeningkatanyangtiba-tibanaikperlahandandipertahankanpadatingkatyangbaru.Jadiinigelombangbaruyangpanjang,katanyasepertidikutipBernama,Selasa.BacaJuga:Waspada,GejalaCovid-19VarianTeranyar,BedadariJenisLainMengomentarikasusyangkurangdilaporkandiaplikasiMySejahtera,Khairymengatakansituasiitubiasaterjadidinegaramanapun.Jumlahkasusyangdilaporkanlebihsedikitdarijumlahinfeksisebenarnyakarenaprotokolpengujiantelahdilonggarkan.Sebelumini,semuaorangmelakukantesRT-PCR,sekarang,sebagianbesartesyangdilaporkanadalahtesRTK-Antigen,katanya.KhairymengatakanbeberapaindividumelakukantesCOVID-19mandiritetapitidakmelaporkanhasilaplikasiMySejahtera.BacaJuga:KinerjaPositifSelamaPandemiCovid-19,SampoernaRaih2PenghargaanBergengsiDalamhalini,kamimelihatindikatorproxy.Kamitidakmelihatterlalubanyakpadajumlahkasustetapitingkatkeparahannya,jumlahkematiandanperawatandirumahsakit,ujardia.Selamaangkanyaterkendali,makamasalahitubisadiatasidenganbaikkarenajikadilihatdarijumlahkasusnyaakanfluktuatif,danakanadagelombangdariwaktukewaktu,katanya.AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisHutapeameyakinibahwatersangkabarudalamkasustewasnyaBrigadirJ,bukanorangbiasa.Menurutdia,tersangkabarunantilebihdariduaorang,bahkanmemilikijabatantinggidikepolisian.MungkindariBrigjenatauIrjenPolisi.Sayamelihatbukansatuataudua,bisatigaorang.Inianalisissaya,kataHotmanmelaluiakunnyadiInstagram,Selasa(9/8).BacaJuga:HotmanParisUngkapKondisiKesehatannyaSetelahBerobatkeRumahSakitDiamengatakanbahwasaatinitimkhususbentukanKapolridanpenyidiktelahmenemukanbukti-buktidugaanketerlibatansosokyangmemilikijabatantinggi.Timsusmaupunpenyidiksudahmendapatkanbukti-buktidugaanbahwainibukansekadartembakmenembakmembeladiri,tetapiadafaktorlainkatanya.PengakuanBharadaEyangmengakudiperintahkanuntukmenembakBrigadirJ,lanjutHotman,akanjadipembelaandalampersidangannantiyangbisameringankanhukuman.BacaJuga:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBharadaEsegerakonsultasidenganpengacaramu,pembelaandenganpasalpidanakita,yaitudugaanmenjalankanperintahatasan,ujarHotman.SeteruRazmanArifNasutioninipunmeyakinibahwakasuspenembakanBrigadirJsudahmulaimenemukantitikterang.

IrjenFerdySamboditetapkansebagaitersangkapembunuhanBrigadirJatauNofriansyahYosuaHutabarat.Foto:Ricardo/JPNNjpnn.com,JAKARTA-MisterikematianBrigadirJatauNofriansyahYosuaHutabaratakhirnyaterungkap.TimKhususPolritelahmenetapkanIrjenFerdySambosebagaitersangka.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MantanKadivPropamituditetapkansebagaitersangkapembunuhanBrigadirJkarenamemerintahkanBharadaEuntukmenembakBrigadirJ.PengumumanFerdySambosebagaitersangkadisampaikanlangsungolehKapolriJenderalListyoSigitPrabowodiMabesPolripadaSelasa(9/8/2022)malam.BacaJuga:BrigadirRRTersangka,ApaPeranAjudanIstriFerdySamboItu?BrigjenAndiSinggung2AlatBuktiKapolrimengatakantimkhususmenemukanbahwaperistiwayangterjadiadalahperistiwapenembakanyangmenyebabkanSaudaraJmeninggaldunia.(Penembakan)DilakukanolehSaudaraE(Bharada)atasperintahSaudaraFS(FerdySambo,Red),kataListyoSigitdiMabesPolri,Jakarta,Selasamalam.Jadibukantembak-tembakansepertiyangdisampaikanpadapenyelidikanawal.BacaJuga:AlasanLemkapiMintaPolriJaminKeamananBharadaE,OhTernyataDalamperistiwaini,timsustelahmenetapkanempatorangsebagaitersangka,yakniIrjenFerdySambo,BharadaE,BripkaRR,danKM.KeempatdisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.IrwasumPolriKomjenAgungBudiMaryotosekaligusKetuaTimsusPolri.Foto:DokHumasPolrijpnn.com,JAKARTASELATAN-Ketuatimkhusus(timsus)PolriKomjenAgungBudiMaryotomengatakanpihaknyamengalamikesulitandalammengungkapkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KesulitaniniterjadipadapekanpertamakasustimsusyangdibentukKapolriJenderalListyoSigitPrabowoitumenanganikasus.KamialamikesulitankarenasaatolahTKPawaltidakprofesionaldanalatbuktipendukungsudahdiambil,kataKomjenAgungBudiMaryotodiRupatamaMabesPolri,JakartaSelatan,Selasa(9/8).BacaJuga:FerdySamboTersangka,KomjenAgusTegasSampaikanKalimatIniPerwiratinggiPolriyangmenjabatIrwasumitulantasmengungkapkanpihaknyajugamendapatkaninformasidaripihakintelijenbahwaadasejumlahpersonelPolriyangmengambilkamerapengawasatauCCTVdilokasikejadian.KamidapatinformasiintelijendariBaintelkamPolribahwadijumpaiadabeberapapersonelyangdiketahuiambilCCTV,ujarmantanKakorlantasPolriitu.Olehkarenaitu,lanjutAgung,pihaknyamembuatsuratperintahgabungandenganmelibatkanDivpropamPolridanBareskrimPolrimelaksanakanpemeriksaankhususterhadap56anggotapolisiyangdidugaterlibat.BacaJuga:FerdySamboJadiTersangka,KuasaHukum:MelindungiMarwahKeluargaDari56tersebutterdapat31personelyangtadidisampaikanKapolriyangpatutdidugamelanggarkodeetikprofesionalPolri,kataAgung.Jenderalpolisibintangtigaitumenyebutkandaripuluhanpersonel,11diantaranyaditahanditempatkhusus.

play666 apk download-๐ŸŽ–๏ธplay666 apk download|XOXE88.COM

MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-MenteriKoordinatorPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDmengharapkanPolribisamemberikanperlindunganyangmaksimalkepadaBhayangkaraDuaRichardEliezerPudihangLumiualiasBharadaE.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberiperlindungankepadaBharadaEagardiaselamatdaripenganiayaan,dariracun,ataudariapapun,katadiadiKantorKemenkoPolhukam,JakartaPusat,Selasa(10/8).Mahfudmenilaipendampinganitusangatperludalamrangkamembuatkasusinisemakinterangbenderang.BacaJuga:BharadaEMauBuka-bukaan,TolongDilindungi,JanganSampaiMatiGegaraDiracunEksKetuaMahkamahKonstitusiitumenganggapBharadaEmerupakansaksipentingdalamkasusini.Kalaudiamenerimaperintah,bisasajabebas,tegasMahfud.Terlepasdariitu,Mahfudmelihatkasusinisudahhampirterungkap.BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanPelakudaninstrukturnyadalamkasusinirasanyatidakbisabebas,katadia.Sepertidiketahui,KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakankepadaBrigadirJ.Satudiantaranya,yakniIrjenFerdySambo.Marshanda.FotodokJPNN.comjpnn.com,JAKARTA-AktrisMarshandamengungkapfaktaterkaitkabardirinyayangdisebuthilangdiLosAngeles,Amerikaolehsahabatnya,SheilaSalsabila.Faktanya,ibusatuanakinimalahdimasukkankeRumahSakitJiwa(RSJ)danmendapatkanperlakukanyangtaksemestinya.KedatangannyakeLAsaatMarshandametimemaindidaerahpantai,VeniceBeachmalahmenjadibencanakarenadianggaphilang.BacaJuga:Jerinx:KalauEnggakKuatMental,Lama-lamaBisaGilaSaatitu,Sheilamenelepondirinyasebanyaktujuhkali.Sheilayangjugamemilikibipolar,mengalamipanickattackkarenatidakbisamenemukanMarshandadanlangsungmenghubungi911.Guetinggalinhpgue,karenagueenggakmauorangtahuguedimana,guemaumetime,ujarMarshandalewatchanelYouTubemiliknya.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiLalu,ambulansmendadakmenjemputnyadijalan.Guebingungkenapa(ambulans)jemputgue,yangpadaujung-ujungnya(guediantarke)rumahsakitjiwa,mentalhealth,sambungnya.

PengacaraHotmanParismengimbauBharadaElakukanini.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-EntertainmentJPNNdiramaikandenganpemberitaanHotmanParisyangmengomentarikasuskematianBrigadirJ.PengacarakondnginimengimbauBharadaEagarmengungkapaktor-aktordibalikkasuskematianBrigadirJ.Selainitu,diajugamenyorotipentapanIrjenFerdySambosebagaitersangkatewasnyaBrigadirJ.BacaJuga:RazmanNasutionKembaliNyinyirSoalHotmanParis,KalimatnyaMenohokNamun,disela-selakehebohanitu,HotmanParisdibawakerumahsakitkarenamengalamikeracunanobat.Pengintahulebihlengkapnya?Simakrangkumanberitanyaberikutini:1.BharadaEDiimbauBeginiMenurutnya,keteranganjujurdariBharadaEdapatmemberikantitikterangbagikasuskematianBrigadirJ.BacaJuga:IqlimaKimBerupayaDamai,BagaimanaResponsHotmanParis?Olehkarenaitu,HotmanParismengimbauagarmemberikanketerangansecaraterangbenderang.Bacaselengkapnya:SarankanBharadaESegeraUngkapKebenaran,HotmanParis:SebelumTerlambatBhayangkaraDuaRichardEliezeratauBharadaE.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenteriKoordinatorBidangPolitik,Hukum,danKeamanan(MenkoPolhukam)MahfudMDinginagarBhayangkaraDuaRichardEliezeratauBharadaEmendapatperlindungan.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudmendorongPolriagarmemfasilitasiLembagaPerlindunganSaksidanKorban(LPSK)untukmemberikanperlindungankepadaBharadaE.Melaluimimbarini,sayajugasampaikanagarPolrimemfasilitasiLPSKuntukmemberikanperlindungankepadaBharadaE,agardiaselamatdaripenganiayaanatauapapun,sehinggapendampingandariLPSKitudiaturdengansedemikianrupaagarnantiBharadaEbisasampaikepengadilandanmemberikanketerangandipengadilan,kataMahfuddalamkonferensiperssebagaimanadipantaumelaluikanalYouTubeKemenkoPolhukamdiJakarta,Selasa.BacaJuga:DikaitkandenganFerdySambodalamKematianBrigadirJ,IrjenFadilBertemuNyomanMahfudmengapresiasipengacaraBharadaE,yakniDeolipaYumarayangmengomunikasikansecarabaikmengenaihal-halyangsebenarnyadialamiolehkliennya.Sebelumnya,Rabu(3/8),PolritelahmenetapkanBharadaEsebagaitersangkadalamkasuskematianBrigadirYoshuaHutabaratatauBrigadirJ.Sampaihariini,selainBharadaE,Polrijugatelahmenetapkanbeberapatersangkalainnya,yaituBripkaRR,KM,danmantanKadivPropamPolriIrjenFerdySambo.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuKeempatnyadisangkakandenganPasal340KUHPsubsiderPasal338junctoPasal55danPasal56KUHPdenganancamanhukumanmatiatauseumurhidup.Dalamkesempatanyangsama,MahfudpunmengatakansegeramenyampaikankepadaPolriagarkeluargaBrigadirJdiberikanperlindungansecaraprofesional.Ilustrasiesbatu.Foto:Pixabayjpnn.com-Esbatudisebut-sebutbisamenyembuhkanasamurat.Kebanyakanorangmengoleskanesbatukeareayangnyeriselamakira-kira10menit.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Lalubenarkahesbatubisamenyembuhkanasamurat?Faktanya,esbatutidakdapatmenyembuhkannyeriasamurat.Kompresesbergunahanyauntukmembantumeredakannyeriasamurat.Bukanuntukmenyembuhkanasamurat.Ketikaseseorangmemilikiasamuratyangtinggidanterjadireaksiperadangan,bagiantubuhyangterkenaakanmengalaminyeridanbengkak.BacaJuga:ParaPriaSilakanMerapat,IniCaraMengatasiEjakulasiDiniSecaraAlamiSifatesbatuyangdinginbisamengurangireaksiperadanganakutpadakasusseranganasamurattersebut.Esbatuyangdikomprespadabagianyangsakitdapatmengecilkanpembuluhdarahyangmembesar.Cairan-cairanakibatperadangandansenyawa-senyawaproinflamasipunkemudianakanberkurang.Hasilnya,nyeriakanmenjadiberkurang.BacaJuga:BeginiSudutPandangIslamTentangOnanidanCaraMengatasinyaCaraTerapiEsBatuSaatAsamUratKambuhSaatmengompres,perhatikancaranyaagarlebihmaksimaldalammeminimalkannyeri.Bungkuspotongan-potonganesbatudalamhanduktipiskemudianletakkanpadasendiyangnyeriselama20hingga30menit.Andabisamelakukannyabeberapakalidalamsehari.KapolriJenderalListyoSigitPrabowomengatakansoalmotifpembunuhanBrigadirJmasihdalamprosespendalamanolehtimsus.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-MenkoPolhukamMahfudMDmemahamikeputusankepolisianyangbelumbuka-bukaanmengungkapmotifkasuspenembakanterhadapNofriansyahYoshuaHutabaratatauBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MahfudMDmendugamotifpembunuhanBrigadirJmasukunsursensitifdanhanyapantasdidengarolehorangdewasa.Mungkinhanyabolehdidengarolehorang-orangdewasa,kataMahfudMDdalamketeranganpersnya,Selasa(9/8).BacaJuga:MenurutKomjenAgus,InilahyangMembuatBharadaEAkhirnyaMauBuka-bukaanMahfudmemercayaikepolisianuntukmengkonstruksimotifdalamkasuspenembakanBrigadirJdemikepentinganpenegakanhukum.DiapadaprinsipnyamengapresiasikepolisianyangmampumengungkapaktorintelektualdalamkasuskematiananggotaBrimobitu.Cumayangpentingsekarangtelurnyasudahpecah,ituyangkamiapresiasidariPolri,ujarmenterikelahiranSampang,Madura,itu.BacaJuga:FerdySamboTernyataBukanCumaMenyuruhMembunuhBrigadirJ,YaAmpun,ParahMotifPembunuhanBrigadirJHarusDijelaskankePublikSementaraitu,anggotaKomisiIIIDPRRIAhmadAlimenyebutpentingbagiPolrimenyampaikanmotifkepadapublikdalamkasuspenembakanterhadapBrigadirJ.Menurutdia,pengungkapanmotifbisamenahanspekulasipublikdalamkasuspenembakanyangterjadidirumahdinasIrjenFerdySamboitu.TaqyMalikbersamaKabareskrimKomjenAgusAndrianto.Foto:Instagram/@taqy_malikjpnn.com,JAKARTA-SelebgramyangjugaseorangpengusahaAhmadTaqiyyunMalikataulebihdikenaldenganTaqyMalikikutangkatbicaraterkaitpenetapanIrjenFerdySambosebagaitersangkapembunuhBrigadirNofriansyahYosuaHutabaratatauBrigadirJ.Timkhusus(timsus)bentukanKapolriJenderalListyoSigitPrabowomenjeratmantanKadivPropamPolriitudenganPasal340subsiderPasal338juntoPasal55dan56KUHPdenganancamanmaksimalhukumanmati.TerkaitperkembangankasuskematianBrigadirJyangakhirnyamenyeretoknumperwiratinggiPolrisebagaitersangka,TaqyMalikmemujisosokjenderalbintangtigainidansepakterjangnya.BacaJuga:IrjenFerdySamboTersangka,AdayangKhawatirNyawaBharadaETerancamSosoktersebutadalahKepalaBadanReserseKriminal(Kabareskrim)PolriKomjenAgusAndriantoyangjugatergabungdalamtimsusbentukanKapolritersebut.BravoKomjenAgus,sosokyangsederhana,berwibawa,dantegas,kataTaqyMalikmelaluiakunpribadinyadiInstagram,yangdikutipRabu(10/8).SuamidariSherelThalibituberharappenetapanIrjenFerdySambodapatterusmenjagakepercayaanpublikterhadapinstitusiPolri.BacaJuga:IrjenFerdySambodiMataKeluargaBrigadirJ,SemuaTerkejutFerdySamboTersangkaKasusPembunuhanBrigadirJ,2PerwiraTinggiIkutTerseretSemogainstansiPolriterusterjagacitranya,Bravo!,ujarmantanmenantupengacarakondangSunanKalijagaitu.(mar1/jpnn)Yuk,SimakJugaVideoini!KapolriJenderalListyoSigitPrabowosaatmengumumkanFerdySambosebagaitersangkapembunuhanBrigadirJdiMabesPolri,Selasa(9/8)malam.TampakjugadisampingSigitadaIrwasumKomjenAgungBudiMaryotodanKabareskrimKomjenAgusAndrianto.Foto:Ricardo/JPNNjpnn.com,JAKARTASELATAN-KepalaBadanReserseKriminalPolriKomisarisJenderalAgusAndriantomenanggapipertanyaanwartawanseputarkasusdugaanpelecehanseksual,yangdilakukanBrigadirYosuaHutabarata.k.aBrigadirJterhadapistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KomjenAgusAndriantomenjawabpertanyaansoalperkembangankasusdugaanpelecehanseksualituseusaikonferensipersdiMabesPolri,Selasa(9/8)malam.MenurutjenderalbintangtigakelahiranBlora,16Februari1967tersebut,kecilkemungkinanterjadipelecehanseksualjikaPasal340KUHP(tentangpembunuhanberencana)diterapkandalamkasuspembunuhanBrigadirJ.BacaJuga:IstriFerdySamboAkanDibawakeRuanganKhususKalau(pasal)340diterapkan,kataAguslalusempatterdiam.Kalau340diterapkan,Agusmengulangkalimatnyadankembalidiamsejenak.Agusakhirnyaberkata.Kecilkemungkinanterjadiitu,ujarnyalantasberlalu.BacaJuga:RaguSoalIstriIrjenFerdySambo,Kamaruddin:PutriyangTertukar?DugaanpelecehanseksualmenjadipemicuawalmunculatautersiarnyaperistiwadirumahIrjenFerdySamboyangkiniresmidisebutpenembakan,bukantembak-menembak.KasusdugaanpelecehanseksualitusendiridisebutdilaporkanPutriCandrawathikePolresJakartaSelatan.KemudiankasusituditarikkePoldaMetroJayadankiniadaditanganBareskrimPolri.

PelayananSIMKeliling.Ilustrasi,Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirektoratLaluLintasPoldaMetroJayamemberikanpelayananSIMkelilingbagipemilikdokumentersebutyangmasaberlakunyaakansegerahabis.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SIMatauSuratIzinMengemudisendirimemilikimasaberlaku5tahunsejakditerbitkan.PoldaMetroJayamenyiapkan5gerailayananSIMyangtersebardi4wilayahDKIJakartapadaRabu(10/8).BacaJuga:Catatnih,5LokasiLayananSIMKelilingdiJakartaHariIni,Selasa9Agustus2022Dilansirdariakunresmi@TMCPoldaMetrodiTwitter,layananSIMKelilingituberoperasimulaipukul08.00hinggapukul14.00WIB.WargaJakartaPusatyanginginmemperpanjangSIMbisadatangkeKantorPosLapanganBanteng.Lalu,wargayangberdomisilidiJakartaSelatanbisamenujukeKampusTrilogiKalibata.BacaJuga:LayananLokasiSIMKelilingdiJakartaHariIni,Ada5LokasiUntukwargaJakartaTimuryanginginmemperpanjangSIMtersediadiMallGrandCakung.LokasipelayanantersebutjugatersediadiLTCGlodokdanMalCitralandHotmanParisbicarasoalTersangkaBaruKasusBrigadirJ.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-PengacaraHotmanParisternyatasempatmemprediksisoaltersangkabarudalamkasuskematianBrigadirJ.Diameyakiniadanyapenetapantersangkabarumerujukdarikasustersebutyangmakinterbuka.Inikasussudahmulaiterbukaluas.Yakinsayadalamwaktudekatpenyidikatautimsusakanmengumumkantersangkadariperwirapolisi,ujarHotmanParismelaluiakunnyadiInstagram,dikutipRabu(10/8).RivalRazmanNasutionitumengakusudahmelihatkemungkinantersebutdaritigaharibelakangan.Sebabmenurutnya,halituterlihatjelasdariarahpenyidikan.BacaJuga:IrjenFerdySamboDitetapkansebagaiTersangka,HotmanParisBilangBeginiKelihatanjelasitudariarahpenyidikanselamatigahariini,kataHotmanParis.Dia,bahkanmenyebutjumlahtersangkabaruyangkemungkinandiumumkanolehKapolri.MungkinitudariIrjenmaupunBrigjenpolisidaninisayamelihatbukancumasatuatauduaorang,bisatigaorang.Inianalisasaya,ucapHotmanParis.BacaJuga:AnalisisHotmanParissoalTersangkaBaruKasusBrigadirJ,BeginiKatanyaTerbaru,timkhusus(timsus)PolrimenetapkanIrjenFerdySambosebagaitersangkakasuskematianBrigadirNofryansahYosuaHutabarataliasBrigadirJ.KapolriJenderalListyoSigitPrabowomengatakanpenetapantersangkaterhadapmantanKadivPropamitudilakukansetelahpenyidikmelakukangelarperkaraSelasa(9/8).

Ilustrasi-KeluargaBrigadirJ.Foto:MRidwan/JambiEkspresjpnn.com,JAMBI-AyahalmarhumBrigadirJ,SamuelHutabaratmengakuterkejutsaatKapolriJenderalListyoSigitmengumumkanotakpenembakanterhadapanaknyaialahIrjenPolFerdySambo.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});SayasebagaiayahYoshua(BrigafirJ,red)tidakmenyangkajikapelakuutamanyaadalahFerdySambodanterkejutmendengarkanpengumumandarikapolri,ucapSamuelHutabarat,diMuaroJambi,Selasakemarin.KeluarganyajugatidakmenyangkajikakejadianberdarahitudilakukanatasperintahFerdySambo.BacaJuga:JumlahPolisiLanggarKodeEtikdalamPenangananKasusBrigadirJBertambahLagi,Alamak!SelamainianakkamiYoshuayangsudahbekerjaselamaduasetengahtahundenganPakFerdySambotidakpernahmengeluhataspekerjaannyadanmungkindisimpannya,agarkeluargatidakmengetahuinya,imbuhdua.SepanjangBrigadirJberkomunikasidengankeluarga,menurutSamuel,putranyaitutakpernahmengatakanhal-halburukselamamenjadiajudanIrjenFerdy.SaatberkomunikasidengankeluargadiJambi,anakkamiYoshuatidakpernahmembebanipikirankami.BacaJuga:MotifPembunuhanBrigadirJHanyaPantasDidengarOrangDewasa?Ah,TelurnyaSudahPecahBegitujugaketikadiapulangkeJambitidakpernahmengatakanhalyangburukdandiaselalumenceritakanyangbaiksaja,ucapSamuel.KapolriJenderalListyoSigitPrabowomengumumkanempatorangsebagaitersangkadalamkasuspenembakanterhadapBrigadirJ.VivoX60Pro.ilustrasiFoto:VivoIndonesiajpnn.com,TIONGKOK-Vivodiam-diamakanmerilissmartphonekeluargadariseriX,yakniX80Lite.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});HalituterungkapdarisetelahnamaVivoX80LiteitudidatabaseGoogleSupportedDevices.TidakhanyaX80Lite,VivoakanmengenalkanHPterbarudalamjajaranIQOOSeries.BacaJuga:VivoX80SeriesResmiDijualdiIndonesia,PalingMurahRp11JutaPonselyangdiberinamaiQOOZ6xitumunculdengannomormodelV2164KA.Hanyasaja,belumadainformasimengenaispesifikasipadaperangkattersebut.Gizmochina,Rabu(10/8),melaporkanZ6xakanbergabungdengankeluargaZ6,yangmencakupiQOOZ65G,iQOOZ6Pro5G,daniQOOZ644W.BacaJuga:VivoY305GMeluncurdengan2KameraBelakang,SebeginiHarganyaPonselseriZ6telahdiubahnamanyamenjadiversiseriVivoT1diIndia.Olehkarenaitu,adakemungkinaniQOOZ6xbisamenjadiversirebrandeddariVivoT1x,yangbaru-baruinimemulaidebutnyadiIndia.

GubernurJawaTengahGanjarPranowoNgomonginPolitika.k.aNgompolJPNN.com,diJakarta.Foto:Ricardo/JPNNjpnn.com,JAKARTA-DirekturEksekutifIndoStrategicAkhmadKhairulUmammenyadariGanjarPranowoseksidilantaibursaPilpres2024.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601113788040-0);});Ganjar,sigubernurdariPDIPerjuanganitumemimpinklasemenelektabilitassurveipilpres.Namun,UmammenilaiGanjarbelumberadadifasemendominasi.MasihadaPrabowoSubiantodanAniesBaswedanyangjugamenggoda.BacaJuga:KomunitasOjoldiJakartaUtaraSuarakanGanjarPranowoPresiden2024GanjarmewakilikarakteristikkeberlanjutandarikepemimpinanJokowi,tetapikendalanyadiabukanpemegangkekuatanutama.Adadinamikayangcukupserius.ApakahPDIPmengusungGanjaratautidak?kataUmamdalamdiskusiGanjarBakalTumbangJikaKeluarKandang?yangdiselenggarakanLingkarDiskusiIndonesiadiBakoelKoffie,Rabu(10/8).UmambilangGanjarPranowomasihpunyapilihanskema.DiantaranyadengantetapberadadiPDIP.ElektabilitasGanjardiJawaTengahcukuptinggi,tetapitidakadagapyangsignifikandenganSudirmanSaiddanIdaFauziah,hanyasekitar6-7persen.ElektabilitasGanjarsaatitu(pilgub)tidakberarti,kemenangannyamelaluimesinPDIP,tuturUmam.BacaJuga:RibuanPemudaKapuasDeklarasikanDukunganKepadaGanjarPranowoDiamelanjutkan,GanjarjugabisajalandengankendaraanKoalisiIndonesiaBersatu,tetapiituakanmembuatKetumPDIPMegawatiSoekarnoputribertambahberang.KononGanjarpernahkenasentilBuMegadisebuahrakernasPDIP.ParapengurusGLPGPPPKpusatdandaerahsaatberaudiensidenganpejabatKemendikbudristek.FotodokumentasiGLPGPPPKforJPNN.comjpnn.com,JAKARTA-KetumForumGuruLulusPassingGradePegawaiPemerintahdenganPerjanjianKerja(GLPGPPPK)IswadimenyampaikanhasilpertemuandenganpejabatKemendikbudristek.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});PertemuandihadiriSekretarisDitjenGuruTenagaKependidikan(GTK)KementerianPendidikanKebudayaanRisetdanTeknologi(Kemendikbudristek)NunukSuryani,KabidPerencanaanGTKAndika.JugaparapenguruspusatGLPGPPPKdiantaranyaIswadi,Nuri,Fulkan,danbeberapaperwakilandaerah.DalampertemuanyangdilaksanakandiKantorKemendikbudristekpadaRabu(10/8),terungkapsejumlahinformasipentingdaripejabatKemendikbudristek,yaitu:BacaJuga:BesokGuruLulusPGDiterimaPejabatKemendikbudristek,SemogaAdaSolusiTerbaikย 1.Dataexcelyangberedarmengenaipenempatanbynamabyaddressadalahtidakbenarkarenaituadalahmasihsimulasi.2.KuotaPPPKyangdiajukanpanselnaskepadaPemdasudahfinal.3.ByNamebyaddresspenempatanPPPKbelumfinal.BacaJuga:GuruLulusPGMasukPendataanHonorer,PenjelasanPanselnasBikinTenang4.JuknispelaksanaanPPPKrekrutmentahun2002turunawalSeptember.MenurutIswadi,hasilaudiensihariinibelummemuaskangurululusPG.Sebab,masihbanyakyangtidakbisaditempatkan,yaitugurubahasaInggrisdanPKWU.

LembagaPerlindunganSaksidanKorban.Foto:Ricardo/JPNN.comjpnn.com,CIRACAS-WakilKetuaLembagaPerlindunganSaksidanKorban(LPSK)EdwinPartogiPasaribumembukaucapanyangkeluardarimulutistriIrjenFerdySambo,PutriCandrawathi.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ucapanitutakpanjang.Yangterucaphanyaitu.Malu,Mbak.Malu.kataEdwinkepadawartawandikantorLPSK,Ciracas,JakartaTimur,Rabu(10/8).BacaJuga:SehariSebelumMenjadiTersangkaPembunuhanBrigadirJ,FerdySamboBerhadapandengan2KomjenIniMalunyakenapakamienggaktahu,imbuhnya.BuPutrimengatakanitusaatdiperiksatimasesmenpsikologisLPSKdikediamanpribadiSambodiJalanSagulingIII,DurenTiga,Pancoran,JakartaSelatan,Selasa.EdwinjugamengungkapkondisimentalNyonyaSambomemprihatinkan.BacaJuga:PagiPresidenJokowiUnggahPernyataanTegas,MalamnyaFerdySamboTersangkaIbuPsukamenangis,murung,tidakbisamemberiketerangan.Adahallainyangspesifikdiobservasipsikiater,tuturEdwin.LPSKmenilaipsikologisPutriCandrawathimasihperluperhatian.IstriIrjenFerdySambo,PutriCandrawathi.Foto:AntaraVideo-SumberVideoFachmyFebrianjpnn.com,JAKARTASELATAN-PutriCandrawathi,istriIrjenFerdySamboturutmenyaksikansaatpenyidiktimkhusus(timsus)PolrimenggeledahrumahpribadinyadiRT07RW02JalanSaguling,KompleksPertambangan,DurenTiga,Pancoran,JakartaSelatan(Jaksel),Selasa(9/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Ketuarukuntanggasetempat,YosefmengatakanPutrihanyamenangisketikapenyidikmenggeledah.Iya,diamenangisterusdikamar,susahkamiberkomunikasi,kataYosefdikutipdariAntara,Rabu(10/8).BacaJuga:KPKBelumBisaUmumkanHartaKekayaanIrjenFerdySambo,AdaApa?YosefmengatakandirinyadimintaikuthadirdalamprosespenggeledahanbersamatimkhususpadaSelasa.KetikaitukeadaanPutriterlihatbaik-baiksajanamunpengacaramenyebutnyamenangisterusdidalamkamar.Yosefmengakumelihatadabeberapaorangyaknipengacara,polisiwanita(polwan),danBareskrimikutdalamprosespenggeledahanselamasembilanjam.BacaJuga:BenarkahPutriCandrawathiMengalamiPelecehanSeksual?IniKataKabareskrimAdajugakeduaanakFerdySambodanPutriyakniseoranganakperempuandananaklelakinyapalingkecilberumur1,5tahunbersamapengasuhnyajugaberadadidalamrumah.KeluargaFerdySambotinggaldirumahtersebutkuranglebihsetahunsehinggabelumterlalumengenalkawasanJalanSaguling.ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,KabupatenBekasi,JawaBarat,yangmerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.ANTARA/HO-PolresSerangjpnn.com,SERANG-ReserseMobile(Resmob)PolresSerangmembekuksatpampabrikKawasanIndustriJababeka,CikarangSelatan,Bekasi,JawaBarat.DiadidugamerampokRp100jutaditokohandphoneSahabatSelulerdiPasarTambak,Kibin,KabupatenSerang.PelakuperampokanituberinisialIB(29)wargaBekasi,kataKapolresSerangAKBPYudhaSatriadiSerang,Rabu(10/8).PeristiwaperampokanterjadipadahariSabtu(6/8)pukul22.30WIB.Saatitu,tokobarututupdansejumlahkaryawansudahpulang.BacaJuga:4MalingMotorDiringkusPolisi,PengakuanMerekaMencengangkanPelakuyangmenggunakantopengdangolokitulangsungmenerobosmasuktokolewatpintubelakang.PelakumasukdanlangsungmenodongkangolokkekorbandanmengeluarkanplastikagarkorbanmemasukkanHPdanuang,kataYudha.PemiliktokoNH(41)pasrahmenghadapiancamanperampokyangakanmembacoknya,kemudianmenyerahkanuangRp100jutakedalamkantongplastik.Padasaatitu,pelakumemintakorbanagarmenyerahkanseluruhhandphone.Namunkorbanmenyebutkanbahwaseluruhponselsudahdimasukkankedalambrankas.Pelakuhanyamendapatkanuanglalukeluartokodanmenguncikorbandariluar,kataYudhaSatria.BacaJuga:PerampokBersenpidiApotekMedanAmbrukDiterjangTimahPanas,Bravo,PakPolisiPerampokBersenjatadiApotekDitembakPolisiDalammengungkapkasusitu,polisihanyamembutuhkanwaktuempathari.PolisimenangkapIBditempatkerjanya,Selasa(9/8).Darihasilpenggeledahan,kataYudha,petugasmengamankansejumlahbarangbukti,antaralainsatuunitHondaVario,duacincinemas,duaponsel,sertasejumlahalatuntukmerampok.(antara/jpnn)BeritaSelanjutnya:IdentitasPerampokyangMenewaskanSopirTaksiOnlineSudahDikantongi,Siap-SiapSajaBekRealMadrid,DavidAlaba(jerseiputih)saatmelawanpemainEintrachtFrankfurt(jerseihitam)difinalUEFASuperCup2022.Foto:Twitter/ChampionsLeague.jpnn.com,HELSINKI-RealMadridmenasbihkandirinyasebagaiRajaEropasetelahmempermalukanEintrachtFrankfurtdifinalUEFASuperCup2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Duagolyangmasing-masingdilesatkanolehDavidAlaba(37)danKarimBenzema(65)membawaMadridunggul2-0padalagayangdihelatdiStadionOlimpiadeHelsinki,Kamis(11/8/2022)dinihariWIB.JalannyaPertandinganBacaJuga:PengamatMintaPSMMakassarWaspadaiKualaLumpurCityFC,IniPemicunyaMadridlangsungtancapgassejakmenitawal.JawaraLigaChampionsituterusmencecarpertahananFrankfurtselakukampiunLigaEuropa.Namun,Madridbarubisamembukakeunggulanpadamenit37.UmpandariCasemiromampudituntaskanmenjadigololehAlabasehinggapapanskorberubahmenjadi1-0hinggaturunminum.Dalamkeadaantertinggal,FrankfurtberupayauntukmenekanMadrid.Akantetapi,skortetaptidakberubah.ElRealtetapmemimpin1-0.BacaJuga:BawaIndonesiakeFinalPialaAFFU-162022,BimaSaktiKokMintaMaaf,AdaApa?Padababakkedua,Madridtampakmasihlebihmendominasi.FrankfurtmasihsajakesulitanmenembuspertahanananLosBlancosyangdikawalduetDavidAlabadanEderMilitao.Madridkemudianmenambahkeunggulannyamenit65.AsisstViniciusJuniordisambutdengansepakanmendatarolehKarimBenzemayangtakmampudihalaukiperFrankfurt,KevinTrapp.

PenampakanpesawatelektrikEHang216yangberencanadioperasikansebagaitransportasiumumdiIndonesia.Foto:Romaida/JPNN.comjpnn.com,JAKARTA-PengusahaRudiSalimberencanamembangunbisnistaksiterbangdiIndonesia.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601110242209-0);});SahabatRaffiAhmaditubakalmenjadikanpesawatelektrikEhang216sebagaitaksiterbang.LantasberapasebenarnyahargaEhang216?BacaJuga:BamsoetDukungPengadaanEHang216sebagaiOfficialAircraftIMIRudiSalimengganblak-blakanmengenaihargaasliEhang216.Namun,diamembuatperumpamaanterkaithaltersebut.Kisaranlebihmurahdarisupercar,deh,pokoknya,kataRudiSalimsaatditemuidikawasanKemayoran,JakartaPusat,Minggu(31/7).RudiSalimmengatakanbiayaperawatanEhang216jugatergolonglebihmurahdaripadapesawatkonvensional.BacaJuga:RudiSalimBerencanaBangunBisnisTaksiTerbangdiIndonesiaSebab,Ehang216beroperasimenggunakandayalistrik.Tenagalistrikyangdiperlukanuntuksatupesawateletrikinijugadisebuttidakbesar.Jadi,sangataffordable,imbuhnya.

BhayangkaraDuaRichardEliezeratauBharadaEdikantorKomnasHAM,Jakarta,Selasa(26/7).Foto:Ricardojpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatinsidenpolisitembakpolisidirumahKadivPropamnonaktifIrjenFerdySamboternyatatelahkembalikekesatuanasalnya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});HalitudiungkapkanKepalaDivisiHumasPolriIrjenDediPrasetyodiJakarta,Minggu(31/7/2022).DiamenyebutkanalasanBharadaEkembalikeBrimobkarenayangbersangkutanmasihberstatussebagaisaksidalamkasuspolisitembakpolisi.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriYa,karenastatusnyamasihsebagaisaksi,kataDedi.IaengganmenjelaskanlebihdetailterkaitdenganalasanpenarikanBharadaEkeMakoBrimob.Sementaraitu,BharadaRichardEliezeratauBharadaEdiketahuisebagaianggotaBrimobyangdiperbantukandiDivisiPropamPolridanmenjadiajudanIrjenPol.FerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhBharadaEdidugaterlibatbakutembakdenganBrigadirNofriansyahYosuaHutabaratatauBrigadieJdirumahKadivPropamPolriIrjemPol.FerdySambodiDurenTiga,JakartaSelatan,Jumat(8/7).Kepolisianmenanganitigalaporandalamperistiwatersebut,yakni:pertama,laporanberkenaandengandugaanpelecehanseksualataupencabulan;kedua,berkenaandengandugaanpengancamandankekerasansertapercobaanpembunuhan.KapoldaMetroJayaIrjenFadilImran.Foto:DokumenJPNN.com/Ricardojpnn.com,JAKARTA-KabidHumasPoldaMetroJayaKombesEndraZulpanmengatakanpihaknyatelahmenghentikanpenyidikankasuspenyuntinganprofilKapoldaIrjenFadilImrandilamanWikipediasehinggamenjadihoaks.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Penghentiankasustersebutsesuaidengankeputusankapoldayangtelahmemaafkanpelaku.Kasusnyadihentikan,kataEndraZulpandiJakarta,Minggu.BacaJuga:PengacaraKeluargaBrigadirJAjukan2PertanyaanBuatIrjenFadilImran,KapolriHarusTahuDiamenambahkanpelakuyangdiketahuibernamaNyomansaatinitidakdilakukanpenahanandantelahdipulangkankerumahnya.Iya,sudahdipulangkan,ujarZulpan.PelakudiketahuisebelumnyatelahbertemudenganIrjenFadilImran.BacaJuga:IdentitasPelakuPembunuhanMayatTerlilitLakbanTerungkap,DiaTernyataPertemuankeduanyaitujugadiabadikandalamunggahanmelaluiakunKapoldaMetroJayadiInstagram.Dariawalsayajugatidakpernahmelaporkan,tidakmerasasakithatisamasekalidenganeditan-editanNyomanitu,tidakada,kataFadilImrandalamunggahanvideotersebut.

PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.IlustrasiFoto:Ricardojpnn.com,JAKARTA-PengamatkepolisianEdiHasibuanmenilaijabatankepalasatgaskhusus(kasatgassus)populerdigunakanpadaeraKapolriJenderalTitoKarnavian.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});JabatanitulalutetapdipakaiolehKapolriselanjutnyasampaisaatini.PembentukansatgasinidibuatsejakKapolridijabatJenderalTitoKarnavianhinggaberlanjutkepadaIdhamAzisdankiniListyoSigit,kataEdidalamketerangannya,Minggu(31/7).BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDirekturEksekutifLemkapiitumenerangkankasatgassushanyabisadifungsikanolehKapolrisewaktu-waktudiperlukan.Diamencontohkansatgasinidiperlukansaatadagangguanperekonomiannasional.Meskidemikian,menurutEdi,jabatankasatgasadalahposisitambahanpejabatKadivPropamPolri.BacaJuga:AutopsiBrigadirJDilaksanakanHariIni,KapolriBicarasoalTanggungJawabSaatjabatanKadivPropamPolridicabut,makadengansendirinyaposisikasatgassusotomatisakanhilang.DanhalituberlakuterhadapIrjenFerdySambo.IrjenFerdySambo.Foto:Ricardo/JPNN.comjpnn.com,JAKARTA-DirekturEksekutifLemkapiEdiHasibuanmeragukanpendapatsejumlahpihakbahwaIrjenFerdySambobisamengintervensipenyidikankasuspenembakanBrigadirJ.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});MenurutEdi,penanggungjawabtimkhususyangdibentukKapolriJenderalListyoSigitPrabowoituialahWakapolriKomjenGatotEddyPramono.TanpamengurangirasahormatsayadenganFerdySambo,diatidakbisamenekanapalagiintervensidalamkasusini.ApalagiketuatimkhususPolrisendiriadalahWakapolriKomjenGatotyangnotabeneadalahjenderalbintangtiga,katadia.BacaJuga:LemkapiYakinFerdySamboSulitIntervensiPenyidikanPenembakanBrigadirJ,IniPenjelasannyaSelainWakapolri,timkhususjugadiisiIrwasumKomjenAgungBudiMaryoto,KabareskrimKomjenAgusAndrianto,danKabaintelkamKomjenAhmadDofiri.Jadi,logikanya,bagaimanamungkinjenderalbintangduatanpajabatanbisaintervensiWakapolri,Katadoktorilmuhukumitu.Edijugamenyampaikanbahwajabatankepalasatgaskhusus(Kasatgassus)yangdisandangIrjenFerdySambosudahmenghilangsetelahkedudukanyangbersangkutansebagaiKepalaDivisiPropamPolridinonaktifkan.BacaJuga:LemkapiAnggapPutusanPDTHBrotosenoPenuhiRasaKeadilanSaatjabatanKadivPropamPolridicabut,makadengansendirinyajabatanKasatgasyangdisandangnyaotomatisakanhilang,kataEdi.Menurutnya,jabatankasatgasmerupakanposisitambahanKadivPropamPolri.

VerrellBramasta.Foto:Instagram/bramastavrljpnn.com,JAKARTA-AktorVerrellBramastadilarikankesalahsaturumahsakitbaru-baruini.Diaharusmenjalaniperawatanlantaranmengalamicederadibagianwajah.Akusekaranglagidirumahsakit,kemarinakujatuh,kataVerrelllBramastamelaluiakunmiliknyadiInstagram,Minggu(31/7).BacaJuga:CiumTangan,AldiTaherMintaMaafkepadaDinarCandyMantanpacarNatashaWilonaitumengakumengalamilukaaliasrobekdibagiandekatalis.VerrellBramastamenyebutlukatersebutakibatterbenturdenganfirehydrant.Akulukarobek,kenafirehydrant,jelaspemainsinetronPutriuntukPangeranitu.BacaJuga:SeringaiKembali,LaluSuarakanProtesuntukKominfoVerrellBramastaketakutanlantaranlukatersebutharusdijahitolehtenagamedis.Demimenghilangkanrasatakut,cowok25tahunitumemilihmelakukansiaranlangsungdiInstagram.Joshua,pembocordatarahasia.IlustrasiFoto:Antarajpnn.com,JAKARTA-KementerianKomunimasidanInformatika(Kemenkominfo)akhirnyabukasuaramengenaidatapenggunayangbisadilihatsetelahmendaftarkanpenyelenggarasistemelektronik(PSE).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601111609478-0);});Diamenegaskantidalbisamelihatdatapenggunameskipunsudahmendaftarkan.Menurutdia,aksesdatapribadipenggunahanyabisadilakukanolehaparatpenegakhukumdaninstansiyangmemilikikewenangan.BacaJuga:KemenkominfoBlokirSejumlahPlatformLuarNegeri,SandiagaUno:TidakBisaSeenaknyaAktivitasitupunharusdalamkondisitertentu.Kamitidakbisamelihatdatapribadisepetipercakapan,kataDirekturJenderalAplikasiInformatika,Kominfo,SemuelAbrijaniPangerapan,dalamjumpapersvirtual,Minggu(31/7).MenurutSemuel,kondisiyangmembuatsebuahlembagabisamemintadatakepadaPSEantaralainadalahuntukmengungkapkejahatan.BacaJuga:KemenkominfoBlokirSteamHinggaOriginKarenaHalIni,Simak!DiamencontohkanPusatPelaporandanAnalisisTransaksiKeuangan(PPATK)bisamemintainformasikepadaPSEuntukmembuktikanpraktikpencucianuang.(Pihak)yangmemintadataharuspunyakewenangan.Kominfotidakuntukitu,kataSemuel.KuasahukumkeluargaIrjenFerdySambo,ArmanHanis,menyangkanperlakuanpublikterhadapkliennya.DokInstagramKadivPropamPolri.jpnn.com,JAKARTA-KuasaHukumIstriIrjenFerdySambo,ArmanHanismengingatkanpublikdanmediabahwakliennyaadalahkorbantindakpidanakekerasanseksual.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Menurutdia,haltersebutkiniseolahtenggelamakibatberbagaiisuliaryangberkembangterkaitkematianBrigadirJ.Segalaisu-isuyangadamembuatdugaantindakpidanakekerasanseksualmalahmenjaditenggelam,padahalnegarayangkitacintaiinimenganutasaskemanusiaanyangadildanberadab,kataArmandalamketerangannyapadaMinggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataArmanmengatakansetiapperempuanrentanmenjadikorbanTPKS,bahkanseorangistrijenderalsekalipun.Diapunmengingatkansemuapihakbahwadalamkasuskekerasanseksual,perspektifkorbanharusdiutamakan.Bahwaapayangterjaditerhadapklienkamisaatiniharusdipercayaisampaiterbuktisebaliknya,jelasdia.BacaJuga:FerdySamboHanyaJenderalBintang2,TidakMungkinBisaMenekanKomjenGatotdkkOlehkarenanya,ArmanberharaptimkhususyangdibentukKapolriJenderalListyoSigitPrabowodapatmengungkapkasusinisecaratuntasdantransparan.HalitusebagaimanaperintahPresidenJokoWidodo(Jokowi),bahwakasusiniharusdiselesaikandanjanganadayangditutup-tutupi.AsnawiMangkualam(depan)saatmembelaAnsanGreeners.Foto:Facebook/AnsanGreenersFCjpnn.com,ANSAN-AsnawiMangkualamberhasilmelanjutkantrenpositifnyabersamaAnsanGreeners.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Terkini,diabarusajamencetakgolkeduanyabagitimberjulukTheGreenWolvestersebut.HalituterjadiketikaAnsanmenangtelak3-0atasJeonnamDragonsdiAnsanWaStadium,Minggu(31/7/2022),padalanjutanKLeague2ataukompetisikastakeduaLigaKorea.BacaJuga:TimBuluTangkisPersembahkanMedaliEmasPertamauntukIndonesiapadaAjangASEANParaGames2022AsnawimencetakgolpertamaAnsandilagaini,tepatnyamenit59,sedangkanduagolsisanyadibukukanolehbraceThiagoHenrique(68,72).Seusailaga,Asnawimengakupergantianpelatihturutmendongkrakpenampilannya.KepecayaandirinyameningkatsetelahAnsanGreenersdilatiholehLimJong-heon.BacaJuga:MenporaAmaliBicaraKesuksesanEkonomidiExpoUMKMASEANParaGames2022Pergantianpelatihturutberpengaruh(penampilannya,red).Sayamakinpercayadiridanmemangsayaakuikondisisayabelummaksimalpadaawalmusim,ucapAsnawiseusailaga.Sayakinimakinpercayadiriberkatkepercayaanyangdiberikanpelatih,imbuhnya.

NikitaMirzanikembalisindirNindyAyunda.Ilustrasi.Foto:FirdaJunita/JPNN.comjpnn.com,JAKARTA-AktrisNikitaMirzanikembalimenyindirpenyanyiNindyAyundadimediasosial.SindiranituterkaitprotesyangdilayangkanNindypadasalahsatumedia.Banyakomonglu,NindyAyunda,tulisNikitaMirzanimelaluiakunInstagramputranya,Azka,Minggu(31/7).BacaJuga:NikitaMirzaniKembaliSerangNindyAyundaGegaraMasalahIniPesohorkelahiran17Maret1986inijugamenyinggungsikapNindyyangselalumenghindariawakmedia.Makanyakalauketemumediajangankaburlu.Gilirandiberitakanmedia,ngamuk,lanjutNikita.Sebelumnya,NindyAyundamengunggahsebuahtangkapanlayarpemberitaandirinyayangbakaldijemputpaksapolisi.BacaJuga:BaimWongDaftarkanCitayamFashionWeekkeHAKI,NikitaMirzaniBerkomentarBeginiNindymelaluiakunnyadiInstagram,takterimadiberitakansepertiitudanmemberiperingatankemediatersebut.MantanistriAskaraParasadyHarsonoitupunmemintamediatersebutuntukmenurunkanpemberitaantersebut.MenporaZainudinAmali.Foto:HumasKemenporajpnn.com,SOLO-MenporaZainudinAmalimengungkapkanbahwapenyelenggaraanASEANParaGamesSolo2022merupakanbentukperhatianPresidenJokoWidodo(Jokowi)terhadapatlet-atletdifabel.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601051053163-0);});Pasalnya,ajanginisudahempattahunatauduakalisecaraberturut-turuttidakdiselenggarakan.ASEANParaGames2022seharusnyatuanrumahadalahVietnam.Namun,merekatidakbersediamenyelenggarakanajangolahragaparalimpiktingkatAsiaTenggaraini.BacaJuga:ApaAlasanPenarikanBharadaEkeMakoBrimob?IrjenDediJawabBeginiAwalnyabukankitatuanrumahnyatapiVietnam.Karenanegara-negaralaintidakbersediamenyelenggarakan,makaatasarahanBapakPresidenJokoWidodountukmengajukandirimenjadituanrumah,kataMenporaAmali.MenporaAmalipunmenjelaskanalasanJokowimemberiarahankepadadirinyauntukmengambilkesempatanmenjadituanrumahASEANParaGameskarenainiakanmenjadiajangbagiparaatletdifabeluntukberkompetisidalammeraihprestasi.Sebab,paraatletparagameskesempatannyauntukbertandingsangatterbatas,terlebihsejumlahajangmultieventharusditiadakandanditundasepertiASEANParaGamesFilipina2019,AseanParaGamesVietnam2022,danAsianGamesGuangzhouyangditundaketahun2023.BacaJuga:KasusKematianBrigadirJDitanganiBareskrim,IPWTegasBilangBegini,SinggungKapolriDisisilain,ajangsingleeventjugasangatterbatas.OlehkarenaituPakPresidenJokoWidodomemberiarahankepadasayauntukmemberimerekaarenauntukbertanding.BelumtentukalaukitatidakjadituanrumahASEANParaGames2022initerlaksana,katanya.

KadivHumasPolriIrjenDediPrasetyoakuiBHaradaEditarikkekesatuanBrimob.IlustrasiFoto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeraliasBharadaEyangterlibatbakutembakyangmenewaskanBrigadirYosuaHutabarat(BrigadirJ)dirumahKadivPropamnonaktifPolriIrjenFerdySambo,ditarikkekesatuannya,Brimob.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});InsidenbakutembakantaraBharadaEdenganBrigadirJkononterjadidirumahdinasIrjenFerdySambo,DurenTiga,JakartaSelatanpadaJumat(8/7).KepalaDivisiHumasPolriIrjenDediPrasetyopunmengakuipenarikanBharadaEkekesatuanbrigademobil(Brimob).BacaJuga:BeginiPengakuanAjudanFerdySambosoalBrigadirJMenodongkanPistolYa,karenastatusnyamasihsebagaisaksi,kataIrjenDedidiJakartapadaMinggu(31/7).Namun,jenderalbintangduaitutidakmemerincialasankesatuanmenarikBharadaE.BharadaEliezeratauBharadaEmerupakananggotaBrimobyangdiperbantukansebagaiaidedecamp(ADC)atauajudanIrjenFerdySambo.BacaJuga:AlasanPolriTarikKasusBrigadirJdariPoldaMetroJayakeBareskrim,OhAnggotaBrimobitubelakanganmenyitaperhatianpubliksetelahdisebutpolisiterlibatbakutembakdenganBrigadirJ.PolisimenyebutbakutembakitudipicudugaanpelecehanseksualdanpenodonganpistololehBrigadirJterhadapistriFerdySambo,PutriCandrawathi.KadivHumasPolriIrjenDediPrasetyodiMabesPolri,Jakarta,Rabu(20/7).Foto:Ricardo/JPNNjpnn.com,JAKARTA-BharadaRichardEliezeratauEditarikdarijabatanajudanIrjenFerdySambomenjadianggotaKorpsBrimobPolri.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});KabarpenarikanBharadaEkeKorpsBrimobinidibenarkanolehKadivHumasPolriIrjenDediPrasetyo.Ya(ditarikkeBrimob),karenastatusnyamasihsebagaisaksi,kataDedikepadawartawan,Minggu(31/7).BacaJuga:BharadaEdanBrigadirJBukanHanyaAjudanFerdySambo,KeduanyaTernyataSosokBharadaEdiketahuiikutterseretdalamkasuskematianBrigadirJatauNofriansyahYosuaHutabarat.BharadEdisebutsebagaipenembakBrigadirJdirumahdinasIrjenFerdySambo.PenarikankeKorpsBrimobinidilakukanditengahprosespenanganankasuskematianBrigadirJmasihberjalan.BacaJuga:LawyerKeluargaSambo:IstriJenderalJugaBisaJadiKorbanPelecehanDedipuntidakmemerinciapaasalanutamaBharadaEditarikdariajudanIrjenFerdySambo.AdapunbakutembakantaraBharadaEdenganBrigadirJterjadidirumahdinasIrjenFerdySambodiDurenTiga,KecamatanPancoran,JakartaSelatan,Jumat(8/7).

KabareskrimPolriKomjenAgusAndriantosaatturundarimobildinasnyadidepanrumahIrjenFerdySambo,Senin(1/8).Foto:FransiskusAdryantoPratama/JPNN.comjpnn.com,JAKARTA-SejumlahpetinggiPolrimenyambangirumahdinasKadivPropamPolrinonaktifIrjenFerdySambo,diDurenTiga,JakartaSelatanpadaSenin(1/8).googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601050029114-0);});Rumahtersebutmerupakantempatkejadianperkara(TKP)bakutembakBrigadirNofryansahYosuaHutabaratatauBrigadirJdenganBharadaE.PantauanJPNN.comdilokasi,sekitarpukul10.46WIB,KabareskrimPolriKomjenAgusAndriantoyangnotabeneanggotatimsusyangdibentukKapolriJenderalListyoSigitPrabowotibadilokasi.BacaJuga:KabarTerbaruKasusBrigadirJ,JenderalBintang2IkutkeTKPBakuTembak,LihatItuJenderalpolisibintangtigaitutampakmengenakankemejaputih.KomjenAgusAndriantotakmemberikanpernyataanapapunsaatturundarimobildinasnyayangberwarnahitam.Sebelumnya,KepalaDivisiHubunganMasyarakat(KadivHumas)PolriIrjenDediPrasetyohadirterlebihdahulu.BacaJuga:KabarTerbaruKasusIstriFerdySambo,PolrijugaPenginCepatKelarSaatini,keduajenderalitutelahmasukkerumahdinasIrjenFerdySambo.AdapunsebagianpetugaskepolisiantampakberadadiluargerbangrumahdinasIrjenFerdySamboitu.PTPanasonicGobelIndonesia(PGI)menggelarpromoPanasonicBagi-bagiKebahagiaanbagiseluruhpelanggansetia,yangdimulaidari18Juli2022hingga31Oktober2022.FotoPGIjpnn.com,JAKARTA-PTPanasonicGobelIndonesia(PGI)kembalimenggelarprogrampromoPanasonicBagi-bagiKebahagiaanbagiseluruhpelanggansetia,yangdimulaidari18Juli2022hingga31Oktober2022.googletag.cmd.push(function(){googletag.display(div-gpt-ad-1601039399667-0);});PromoPanasonicBagi-bagiKebahagiaaninimerupakanwujudnyataPGIdalammemberikanprodukjugalayananterbaikbagipelangganuntukmendapatkankesempatancashbackhingga50%,padasetiappembelianproduk-produkPanasonicmelaluiWheelofHappiness(WoH).KeisukeNakagawa,PresidentDirectorPTPanasonicGobelIndonesiamengatakan,inisiatifpromodipertengahantahuninidiberikantanpamelihatadanyaharispesialataupuntanggalcantik,karenasalahsatuorientasibisnisPanasonicGOBELadalahmeningkatkankepuasanpelanggan.BacaJuga:HukumBerhubunganBadandiWaktuyangTerlarangPanasonicterusberupayamenciptakanLiveYourBestmelaluisetiapinovasilayanandenganmengadakanprogrampromoPanasonicBagi-bagiKebahagiaan,agardapatberkontribusidalammemberikankebahagiaandankesejahteraanbaikbagikonsumenmaupunmasyarakatdiseluruhIndonesia,ujarKeisukeNakagawa.Untukmendapatkanpromoinicaranyasangatmudah,konsumentinggalmembelisalahsatuproduk-produkfavoritPanasonic.Kemudiansetelahmelakukanpembayaran,setiappelangganberkesempatanmendapatkanpotonganhargadenganmelakukanSpinTheWheelsofHappinessdiwebsitebagibagikebahagiaan.com,ataudapatmengaksesdenganscanQRCodepadaBanneratauMateriPromosiyangadadisetiaptoko.BacaJuga:MenparekrafSandiagaBantuWargaKubuRayaTingkatkanPenghasilanLewatLidahBuayaTerpurukKarenaPandemi,2UMKMdiBaliIniBerhasilBangkitBerkatGoDigitalLangkahkedua,isibiodata,kategoriproduk,nomormodelproduk,nomorseri,tokopembelian,nomorkartugaransi,fotokartugaransisertafotoinvoice,danlangsungputarWheelsofHappinessuntukmendapatkancashbackdariRp25.000hinggaRp3.000.000,-dalambentukvouceryangakandikirimkankenomorteleponataue-mailyangsudahdidaftarkan.Kamiinginselalumemberikankejutandankebahagiaanbersamakonsumenmelaluiberbagaipromoyangkamibuat.MelaluiPanasonicBagi-bagiKebahagiaandiharapkandapatmemberikanmanfaatkepadasemuaorang,termasukpelanggansetiaPanasonic,seruMarketingDirectorPTPanasonicGobelIndonesiaYukiHonda.(chi/jpnn)